SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015739 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015739
Domain Number 1 Region: 228-352
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 6.8e-58
Family Dystroglycan, domain 2 0.000002
Further Details:      
 
Domain Number 2 Region: 513-613
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000137
Family Dystroglycan, N-terminal domain 0.026
Further Details:      
 
Domain Number 3 Region: 111-205
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000314
Family Dystroglycan, N-terminal domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015739   Gene: ENSXMAG00000015708   Transcript: ENSXMAT00000015762
Sequence length 908
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556726.1:1599276:1615912:-1 gene:ENSXMAG00000015708 transcript:ENSXMAT00000015762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPSWWFTDICCAAQRPLDMHYILYRDMSCRDAGRSRFPSCRTLPVVIWLLATLAHGAMP
DQQETLVDMISVELEASMQSSVMSELQAAASSVGEGPPTAIPDSSVGNGVHTNIPDSSAI
VGQVFQLKVPPGPDHASCNIQLTEMGRETLPSWLYWDKERCTLRGLALEQDKGVYHILVS
GEQITEGTSSQVYPSTVFTVEVYPEERADTEPALLTLQSDISGLQPFTCGSEEPVTVLTV
ILDADLTKMVAEQRVSLLGLMRKFSHVPLEHMRVVPVVNNRLFDMSAFMAGPGNAKKVVE
NGALLSWKVGCALDQPSIPDISSVQSSAKDGTMSARLGYPVVGWHIVNKKPHVVKRIRRQ
LYNTPTPVPSLLPPTVNQEPLSRVVPTPTSPSIAPATDNSTPPVRGPLPLPVKPTLRVKD
QIAHTPVFGPPQPTRVLGTTSTIPIMPTMTRPTILGPTASPTPPGASKKPKTSKKPKKPR
MSTPAPREPKSTTPKTTIRTTTLTLTTDLNQNPEIRNPIDQVTAWVGTYFEVKIASDAFY
DREDGTTDKLRLTLKKTPKEAVSETSWIQFNSSIQLLYGLPDEEHAGDHEYFMLATDKGG
KSIMDAFEVRVNRWTSNDKPSVVFAARFHGDPKTLSENVHNKILLTKRLAYALGDRNTST
VTLRSITKGSIVVEWTNNSIQQNFCPKEQITALTKRISDSQGTPSPAFIKAMEPEFKPIS
ISVRGTNKCQSYTFIPPGEVPMPALPTATPSPGTSQRSSDDVYLHTVIPAVVVAALLLIA
GIIAMVCYRKKRKGKMTIEEQATFIKKGVPIIFADELDDSKSPPSSSIPLILQEEKPPLP
PPEYPNMAGPHSTLLNQDLLEEYSVYQDDDPNAPPYQPPPPFTVPIEGKGSRPKNMTSYR
SPPPYVPP
Download sequence
Identical sequences M4AMP5
ENSXMAP00000015739 ENSXMAP00000015739 XP_005801731.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]