SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016218 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016218
Domain Number 1 Region: 189-420
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.23e-59
Family Voltage-gated potassium channels 0.00065
Further Details:      
 
Domain Number 2 Region: 34-142
Classification Level Classification E-value
Superfamily POZ domain 1.1e-31
Family Tetramerization domain of potassium channels 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016218   Gene: ENSXMAG00000016193   Transcript: ENSXMAT00000016242
Sequence length 828
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556674.1:166195:203936:-1 gene:ENSXMAG00000016193 transcript:ENSXMAT00000016242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKSLDLNKAGSRSTSSLPPEPVDIIRSKSCYRRVRLNVGGLPHEVLWRTLDRLPRTRLG
KLRDCNSHDSLMEVCDDYNLEENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQE
LDYWGIDEIYLESCCQARYHQKKEQMNEELKREADNLKDRDGEEFDNTCCAEKRKKLWDL
LEKPSSSVAAKILAIISILFIVLSTIALSLNTLPELQGTDEFGQSTDNPQLAHVEAVCIA
WFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQI
FRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEED
TKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSE
FYKEQKRQEKALKRREALERAKRNGSIVSMNLKEAFARSAELMDVVVEKSERPHDNHLSP
SHWKWASKRAASETSSNRSFNAQEIGSPCKARDTSPQRLNVEKLEEMYSQMAKTQSQPNL
NAKDRGSRVSKQRDEIELGAIHDYGPSVLGAKDGVGDMKSLSSIDSYISCATDFQENPRY
PHSPAADIGLKESTRFTFGPVTVLSQHISKRIGHQIIGQHESVLSPGLKSSGPENTRRFL
FSGNSSKSLKGGCRSDGDSGPSPLSDSSVVSDQSLLSPEASVYTTASSRTPPKSPDSTAM
APTVFTFHDSSISKYIDADTDDDEHLRDITEASPSDRLLAGGSPKRSININYQRGTNHLE
AAQKMLGQNCYFPLEGIRGKAHENHIGPDPARRPKAERGRQNTLDKGL
Download sequence
Identical sequences M4AP23
ENSXMAP00000016218 ENSXMAP00000016218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]