SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016276 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016276
Domain Number 1 Region: 860-908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000201
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 2 Region: 1122-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000248
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 1013-1065
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 4 Region: 394-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 5 Region: 264-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000115
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 6 Region: 331-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 7 Region: 906-956
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.0048
Further Details:      
 
Domain Number 8 Region: 966-1015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family Laminin-type module 0.098
Further Details:      
 
Domain Number 9 Region: 495-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 10 Region: 1170-1215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1309-1336,1441-1663
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00000212
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.008
Further Details:      
 
Domain Number 12 Region: 1065-1119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000725
Family Laminin-type module 0.0092
Further Details:      
 
Domain Number 13 Region: 446-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000206
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 14 Region: 812-853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000865
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000016276
Domain Number - Region: 103-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0085
Family N-terminal domain of xrcc1 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016276   Gene: ENSXMAG00000016220   Transcript: ENSXMAT00000016300
Sequence length 1780
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556669.1:2183713:2206542:-1 gene:ENSXMAG00000016220 transcript:ENSXMAT00000016300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILIFIFVCLPAVKPQDLQDQCPGGSCHPQLGDLMVGRGAQLSASSTCGVDGPQNYCIVG
YLEGEKKCFTCDSRLPFSPQGNPQSHRIENVITTFDSDRRLKWWQSENGVHQVSIQLDLE
TVFQFSHLVLTFKSFRPAAMLVERSKDFGQSWKVFRYFADDCSLHFPSVPAEPAGFIDDV
VCDRRYSGPEPSAGGEVVLKALDPVFEIDDPYAPNIQELITLTNIRVNFTRLFTLGDTLL
ARRRRDPQEKYYYSLYSMVVQGSCFCNGHASRCVPVDGGRGDVFTQSDMVHGRCVCQHNT
AGENCERCQPFHNDSPWKPGGETTPNICRRCNCHGHSDSCHFDAARYEETGGASGGVCDD
CRHDRTGPQCERCRPFLYQDPQRALEDPHACIPCDCDPAGSHSGGLCDASSGRCLCKENV
EGQRCDRCKHGFFNLRSDNPAGCEVCRCHGLGSVGPCDPLTGSCKCEPMATGLLCDHCVA
GFWGLGNSVFKCSPCDCDVGGASSNMCSSEDGQCSCLPNMVGRRCSDPAPGYFLPSLIYF
LYEAELAAQLTGGSSSPTPPAPLPVFPSSSPLVNPALLPSCEQYFRRQGYDFRISNGKVI
LIRRPRHLTHRRRRQNTNPLNRGPLQILPHQGSPEQSGTGLGLVRVTEGVGLRFTVDNLP
TSMEYQLVIRYESESVTDWVARVNIITLSPGDGGCSDDPPSGSLTLILPRSSRLSILDSR
VCLNARGRYYVEIFFDRQQGSDYAPLLVDSMGLVQSFYSVQDFCSQSDFDSFSHFRCVGL
DVYLGSQESLPKICEGLIKSLSARIHNGAVACTCNVIGSLGSGCSTLGGLCDCKPSVIGR
CCDACAPLTFGFGPEGCKRCECDPQGSLSEACDPSGGQCACRPRVSGRRCDRCESGFWGF
PLCQPCDCNGLSETCDGWTGQCVNCREHSSGPHCDRCVEGYYGNPVSRQPCQPCLCPDIL
SSGRFFASSCRYDPQSVRVSCSCREGHTGERCDRCSSGFYGDLRLPGAVCRACSCNNNID
PDDSNACDGTTGECLRCLHYTTGPRCQFCKPGYYGNALQHNCKECSCDRRGTKATLCPLE
SPCFCNRETGQCPCRTGVVGNLCDECENGFWNLDGASGCQPCSCDPSNSVSNICDKVSGQ
CPCRPEFGGRQCDECGENYFGNPDLQCFSCDCNLEGTQRPSCDPETGECICRTGVTGILC
DECTPGYSSEFPACEKCHECMVLWSENVTDVQRAAQRMRTFILLHGNTQHSTHSQYWQRM
LEIHSRLDSFGNMTGFSLPKLEKVEKLYMKIRKMKDAVDTNIILIDPSVLLNNEINNINV
EFQKMLKNLKDKLIKDPNKKETQPVEEMLQEIQKLHKTFMSDEKRVRNSNKAVEDSMDTR
WETKRKLSMWSGREDLATLEKKVKVLNMRQLNQKVCGQPDPEDCSGCPGGQICDGAVPHA
QKASETAEKVKEQLIKFPSSLDESKKKISDVQQVAQDTKDQAQDLQRQISDITKSVEREK
NKTRELLQRAKQYLMDEMVPPGDIEKMANAVLRIQLPQSPAEIQSMINEINKLLNNKFQE
DLKKLQDEAKTAQELLQKATDVKEQTKSINVKDILSDIIAADTAQSKANDDLEVANKDRD
DATDRIQEMENKLNDIEDKLMNQTVGLLEESEALKNKTEQNREMAKEARETAESALTNIS
NDTELQGVQEQFELLKQKHLNKTLEDEAADRLQKILKEIEDMQRQMEDRLQQIEDVEQKI
QLLIQRKEEKIVEVADLLNTVESLQKEIISKAQYYVTCSS
Download sequence
Identical sequences M4AP81
ENSXMAP00000016276 ENSXMAP00000016276 XP_014329261.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]