SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016372 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016372
Domain Number 1 Region: 1040-1236
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000283
Further Details:      
 
Domain Number 2 Region: 827-954
Classification Level Classification E-value
Superfamily PH domain-like 2.25e-26
Family Pleckstrin-homology domain (PH domain) 0.0000126
Further Details:      
 
Domain Number 3 Region: 36-68,97-170
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-18
Family PDZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016372   Gene: ENSXMAG00000016331   Transcript: ENSXMAT00000016396
Sequence length 1793
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556667.1:3744062:3779167:1 gene:ENSXMAG00000016331 transcript:ENSXMAT00000016396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRWAPTFEEDERQQARSSFCENDSAERRSLADCPAVQYSTEEEPFAWPRPKTVRLRRT
SLGFGFTLRHFIVYPPESSLHCFPEEDCGRRVWRQRNRLEPMDTIFVKQVKEGGPAHEAG
LCTGDRIVKVNGASIIGKAYSEVITLIQDSGDVLELCVMPKDEDILQLVRPFSKETTNLA
YSQDAYLRGYNSYSGNASHIPDPPVVCYPRVDCKPTGMAQATDSSGQICRGPAASLDYGY
RKEITVPPSPPRQYSKSQTAVCMRNDSVRTVVVPPNSAHMGQVVSAQRVDFMDPAYVRGR
PGSLAQYPFPRKVDVYPSGPGMVPFTGQAPNYPGNHQNIDWRTYQTYREYIDNKGIHSHG
SRTIQERLDNLRTAGHPSFATASHIPRGAWVPKGIRRRSTSHERSYHGPPPHFQVAPRSA
SQDRMRNPEKISNPRNWPPRSVSQDALALKVRSHSIDYVEPVELARPSERRAGYSRADQG
TRPSRQAMPRNAVPFRPSAGYSGGIRGAPNPSFFSKGPDSLQTRSSPMLSAMLFGKSTEH
SFTDQRVSVPAHHLGHTSQPGQNRMRSETIQISEAGRELAPSKCGVGIRSSSCSATKEIP
QRPGILKTAHQDSQSQVNGQSPSEPAVVLREKPHGGKNPSPLRHPSYILAVNDEGTDSTA
DVAACWLPNDTRREIHMRRLEEQRHNSCSSNLDETLDAIPFIDEPVSPSVDREAAPIPPS
AVISVAPSIATAPSSQGSPCPTIHRQLSHDQESMRSAVLDSDSASKTERSKSYDEGLDNY
QEERRGSTSKHMASFRGLRKTLDGHKPTGDSGSRRESSLDVFADSSKEGLLNFRQLSTEK
NKRVGGGMRSWKQMYAILQGHTLTLYKDKKDALSHAASQSDEDPLRISIKACLIDISYSE
TRRKNVLRLTTSDCEYLFQAEGREDMLSWIRVIQENSNPDEENPSVTSQDLISRKIKEYN
MMSSRSEPSPKSSRQSLSIKQAFLGGKTEGRSHSSHSPRTGEDRRVMKDESSPPRDRGAW
KIGIAGIMKKPFEKKQAGITFGVRLEDCPPAQTNRFVPLLVEVCCQVVEERGLEYTGIYR
VPGNNAAISSMQEELNTKGMADIDIQEDKWRDINVISSLLKSFFRKLPEPLFTNEKYDKF
IEASRTEDSVERLKELKRLVYELPTHHLETLKFLCAHLKKVSDNCEQNKMEPRNLAIVFG
PTLVRTSEDNMTDMVNHMPDQCKIVENLVQQFDWFFMEDGSEDPVTVVEQESTVQSQPVP
NIGHLLTNISRVPASSGEVSDTACPDSNKSKGLWISGNQCSKEMLRSSIFANRKRKKNKE
KSQLSSSDDDLDSGFNKKELPEEGQRPLWSQVSQGEDSGQTDEDGEKDKHRSSSDETIRK
ESESVASLPGEHVPSGHQMPPYASPSSSPNLNYRMAVTHQSSLSDPPSNYDDTVSDLGTM
NSTSSQASVPRVRRNKTAVLGADTCPGGLGAEVCSITSDYSTTSSMTFLTGAETCTLSPE
VQSVSESRGGEDADDERSELISEGRPVETDSESDLSVFTIGKAEKSKLPESTRPLPSHRL
IECDTLSRKKSSKQKTESETSLDDKDPNRLSQAVGSAKGRSSGSLSSSSRSELDKMEPAW
KLKITDRLKVRLRMSVDDMFGVGSQRSRSPEGRSKKKNIRRRHTMGGQRDFAELSTLGDW
SQPVSSRSELSAVDRLKPKCSSQDFSIGDWIARERHRTSNPEVSLDLSEQLGALCSSNSQ
NSGASSSSELARGPAEALNGEISQSKNLSLSATAHPHKLTSSQVVHSRFYQYL
Download sequence
Identical sequences M4APH7
ENSXMAP00000016372 ENSXMAP00000016372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]