SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016382 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016382
Domain Number 1 Region: 5-88
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.96e-18
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0015
Further Details:      
 
Domain Number 2 Region: 443-505
Classification Level Classification E-value
Superfamily F-box domain 0.000000567
Family F-box domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016382   Gene: ENSXMAG00000016354   Transcript: ENSXMAT00000016406
Sequence length 639
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556745.1:433876:445417:1 gene:ENSXMAG00000016354 transcript:ENSXMAT00000016406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQLLETVERLQSRIQDNPEPRKLLKTLKRLGEVQMTVDILVRTGVGKTVNSFRKHDYA
GELAKSLVAKWKKLVPQTADRPNSHPKPAPQSHHRSYTEPSPEEQRSYVEEEEDEEVEEE
EEMVYHSNYSPSPPQQQQYSPPQRSGYESEEYEPEPSPPPLPPPPLPPPRKEIRHSKPSK
NHHHRDEERWQAGSDRGGGKKRSADRERTNSPPPQKKHSRKSTPHDTKKEEKKKGGEDGR
PRPPKDPPPSKEDDDDFEAHTMSFESFLTYDAPTPVKKKKKQQPSSSSHSRPSQSSSGSS
SRQNRTAASSSSSSSSSSKANKANGSQSSKRSHSDSKSSEPKPEKRKRVVEALPTLPDIP
LPAIQPNYRPLPSIDTPLSPQRRKVPVCNDEEDAGFTGKRFNSKMVVYSGSKTSYLPRMM
TLYEQCIRVLQNNIDSIAEVGGVPFEILEPVLERCTPEQLYRIEQSNQCFTEDSDELWMR
HCRRDFKRESPQEFESWREMYLRLHDEREERLRLLTQNISSAHANKPKGRQVKMAFVNSV
AKPPRDVRRRQEKFGTSSSSSSTSTAAASPIKIKPASSDFAGDSSHSSSHFSSPAGSSRS
SAPPGGGTVHPGREKPQVKKIAPMMAKTIKAFKNRFSRR
Download sequence
Identical sequences M4API7
ENSXMAP00000016382 ENSXMAP00000016382 XP_005802925.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]