SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016585 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016585
Domain Number 1 Region: 92-211
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.33e-18
Family Growth factor receptor domain 0.0043
Further Details:      
 
Domain Number 2 Region: 482-554
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-18
Family TB module/8-cys domain 0.00058
Further Details:      
 
Domain Number 3 Region: 597-725
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.73e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 200-264
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.11e-17
Family TB module/8-cys domain 0.00013
Further Details:      
 
Domain Number 5 Region: 2-123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.35e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 276-405
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 722-838
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000738
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 557-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000013
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 9 Region: 436-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000553
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 396-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000153
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000016585
Domain Number - Region: 932-976
Classification Level Classification E-value
Superfamily Cadherin-like 0.0183
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016585   Gene: ENSXMAG00000016557   Transcript: ENSXMAT00000016609
Sequence length 1016
Comment pep:known_by_projection scaffold:Xipmac4.4.2:AGAJ01039647.1:379:14079:1 gene:ENSXMAG00000016557 transcript:ENSXMAT00000016609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNECVENPGICNPGQCIDTLGSYRCLCPNGYKTTADRSMCVDVDECERQPCGNGTCKNTV
GSYNCLCYIGFQNSHNGDCIDIDECSTQRGLCRNGQCLNSVGSFFCVCNDGYEITSDGRL
CTDINECAVNPKPCGLGTCDNMDGSYRCICPPGYYLHEETCKDIDECVQSPENCMFGKCT
NFEGSFTCECPEGFQLSASGRRCLDIRVNYCYTKFENGRCLTPKALNTTKAECCCTFMPG
QGWGSPCEICPRKDEDAYRVLCPNEGYKRGPDDSPKDIDECLNDPCINGQCINIDGSFRC
ECPLGYSIDISGITCEDTNECEIGNPCGNGTCANVVGGFECACDDGFEPGPMMTCEDINE
CSQNPLLCAFRCVNVIGSYECKCPTGYVLREDRRMCKDQNECEDGIDDCSSRGMTCKNLI
GTYMCICAPGYTRPPNGDGCMDLNECSAKPGICKNGRCENTVGSYRCRCDQGFVANPTQT
ECIDNREGFCFTEVLTTLCQMSSSNRNLVTKSECCCDGGRGWGTTCELCPLPATTQYKKM
CPLGPGFTTDGRDIDECRVMGNLCKNGRCLNTLGSYNCVCKPGYTTDITGTQCVDVDECI
QAPKPCNFICKNTEGGYLCSCPRGYALQEDGKSCRDLDECSTKQHNCQFLCVNTIGGFTC
KCPPGFTQHHTACIDNNECSTDPNLCGSNGVCQNSPGSFNCDCQRGYSLDPSGQSCEDMD
ECDGNHRCQHGCQNLVGGYRCSCPQGYLQHYQWNQCVDENECLNSQICGGASCHNTLGSF
RCLCPTGFNYEQSTGGCTDINECSTSHNPCKFGCSNTDGGYLCGCPPGYYRAGQGHCVTG
LGFTSGSVSGGQGGEEDDNSLSPEACYECKINGYPKKGRKRRSVNSTHLTEDNTVSLASM
DIENTLQLHLNTSDLSNREHILEFTPALSTLSDHVRYSIDNGNEEGLFKINQRDGVSYLH
LSKKKVLPPGVYNLQISSVPLYRKKELAELEDQHDKDYLTGQLGDVLKMRVQLILH
Download sequence
Identical sequences M4AQ40
ENSXMAP00000016585 ENSXMAP00000016585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]