SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016628 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016628
Domain Number 1 Region: 817-874
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 2 Region: 877-929
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000549
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number 3 Region: 699-755
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 641-698
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 5 Region: 51-86
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000432
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 582-638
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000902
Family TSP-1 type 1 repeat 0.0086
Further Details:      
 
Domain Number 7 Region: 759-812
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000262
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016628   Gene: ENSXMAG00000016588   Transcript: ENSXMAT00000016652
Sequence length 980
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556668.1:1857454:1898112:-1 gene:ENSXMAG00000016588 transcript:ENSXMAT00000016652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEVRIWSIRLSVQLLLWSQLLDSQQTADHRKVPQRTESQQEFRSEYGEIQGAWGTWGAW
STCSRTCGKGVQEQTRPCLPVYTQYPSRGAAVQPQQPGHVISALKPAAAPRHSGVRAFNN
SSSRGELRREKQSRPGERSSAGTLFWDTVYRTWKVTHIVPGKYGYGRAPHVAPLLVDSGR
GSASPRLHRQKRSPAANSLQAFPRGHNNLRSHKLDASNNLHRFTRPYVHPRTQHPRNNQL
WTSLYQPVSSNQAEVQTGSHTSSHQLHKERPYNPLPSSFCTGEHAHYRICNSNDCPPSSK
DIRAVQCSSYNNQPFMGRLYKWEPFNEVSGGQHCELNCRATGFRFYVRQSDRVIDGTPCG
QNETNLCVAGRCTSLGCDEYLGSVKVVDKCGVCGGDNSTCRLVSGVFKHSLSKIGYHKIV
EIPEGATRINVTEMVKSRNYLALRSRSGRSIINGNWAIDRPGKYEGGGTTFTYRRPNEIS
STAGESFLAEGPTNEILDVYMIFQQPNPGVHYEYILPSEKIVKPQQPTQTAEESARGEDE
YTQQIHTQQENFNSAGGGRYHPHLPDNQVPAVVPPRRDREYNWKLTGTTECSASCGKGFR
NSIFRCVHRLNHVEVSDAFCESSSRPGPQEEACNLQPCPAFWDIGEWSECSKTCGLGMQH
RQVLCRQVYANRTLNVHMSRCQHLERPETASTCQLKICSEWQIRSEWTSCSVPCGVGQRS
REVRCVSNVGDFVPDEECNMNLRPTNVENCDMGACAKSWFYTEWGNRCSAECGMGVRTRS
ILCLTNHISSLPLEGCGSEQPADSQVCNNGPCDNRIEWFTGPWSQCSAECGTGSQQRSVV
CLVKSDEGFTVMPPYECSSLDRPLSQQSCNIKTCGAKWYHTDWSACSKTCEGGFRVREVR
CLSDDMLSSEACDEQLRPADREDCSPEPCIPQIDLNCRDKYYNCNVVVQARLCVYDYYKT
ACCASCSRIAHKQKVHRGHS
Download sequence
Identical sequences M4AQ83
ENSXMAP00000016628 ENSXMAP00000016628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]