SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016702 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016702
Domain Number 1 Region: 679-874
Classification Level Classification E-value
Superfamily Sec7 domain 4.58e-74
Family Sec7 domain 0.00000239
Further Details:      
 
Domain Number 2 Region: 92-165,441-621,1133-1535,1663-1804
Classification Level Classification E-value
Superfamily ARM repeat 2.56e-29
Family MIF4G domain-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016702   Gene: ENSXMAG00000016622   Transcript: ENSXMAT00000016726
Sequence length 1830
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556818.1:1000741:1029165:1 gene:ENSXMAG00000016622 transcript:ENSXMAT00000016726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEQRQRPPREQQRQHSQSGNSKTKSMFLSRALEKILSDKEVKRSQHSQLRKACQVALDE
IKEELEKQKDGTVVPPKANYIEADKYVLPFELACQSKSPRIVSTSLDCLQKLIAYGHITG
NAPDSKAPGKRLIDRLVETICNCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTVLLT
VRTCYNIYLASRNLINQTTAKATLTQMLNVIFTRMENQAALEAQEQEKERLRLPHQNPSP
VPGGRRSGSPRSDRTSTPEPPSPGVSTPDLSTNADTTRSTTPPPPAADPDTDRPSVNGEA
EDGGSEQVTPSRDSVFEDEGVEKHPVAAQEGNKSNPAESVAAEGEPGQTHSGTDGEPPVH
STPEQTEVAPSRGRTEAQQMNGIIEDRTSVSSADILDADALHGPNNTARFSHILQKDAFL
VFRSLCKLSMKPLADGPPDPKSHELRSKIVSLQLLLSVLQGAGPVFRTHEMFVNAIKQYL
CVALSKNGVSSVPEVFELSLAIFLTLLSHFKVHLKMQIEVFFREIFLTILETTTSSFEHK
WMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRSGQELGMTPLQE
LSLRKKGLECLVSILKCMVEWSKDMYVNPNLQANLGQEHPPDSEGGELKLPEQTAGRRDS
VSSLDSNYSSITMSQADHPEQYEVIKQQKDIIEHGIELFNKKPKRGIQYLQDQGMLSSTA
EEIAQFLHQEDRLDTTQVGEFLGENTKFNKEVMYCYVDQLDFCGRDFVSALRTFLEGFRL
PGEAQKIDRLMEKFAARYLECNQGQTMFASADTAYVLAYSIIMLTTDLHSPQVKNKMTKE
QYIKMNRGINDSKDLPEDYLSSIYDEIAGKKIAMKESKEFSITPKSTKQSVASEKQRRLL
YNMEMEQMAKTAKALMEAVSHAQAPFFSAKHLEHVRPMFKLAWTPLLAAFSVGLQDCDDP
EVASLCLEGIRCAVRIACIFSMQLERDAYVQALARFTLLTASSSITEMKQKNIDTIKTLI
TVAHTDGNYLGNSWHEILRCISQLELAQLIGTGVKTRYISGVVRDREGSIRGLPPGTEEF
MPLGLGNLVGSQDKRQMAHIQESVGETSSQSVVVAVDRIFTGSTRLDGNAIVDFVRWLCA
VSMDELASAHQPRMFSLQKIVEISYYNMNRIRLQWSRIWQVIGDHFNKVGCNPNEDVAIF
AVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIRDMVIRCVAQMVNSQAA
NIRSGWKNIFSVFHQAASDHDETIVELAFQTTGHIVMKTFPEHFAAAIDSFQDAVKCLSE
FVCNAAFPDTSMEAIRLIRHCAKYVSERPQALREYTSDDMNVAPGDRVWVRGWFPILFEL
SCIINRCKLDVRTRGLTVMFEIMKSYGHSFEKHWWHDLFRIVFRIFDNMKLPEQQTEKIE
WMTTTCNHALYAVCDVFTQFYEPLSEILLQDIFTQLQWCVRQDNEQLARSGTNCLENLVI
LNGEKFSPEVWDVTCSCMLEIFQNTSPHALLTWRPAGQDEEAAEGKHFEADFDSQSQSSF
DRALSERGHSQMSSDDTWKGKSSARVSDQRLFAGLLIKCVVQLELIQTVDNIVFYPATSK
KEDADNMAAAQRDALEQSEAAGEEPAPDQGMYRHMTSAHLFKLLDCLLESHNFAKEFNSN
NEQRTALWRAGFKGKSKPNLLKQETSSLACSLRILFRMYSDPKLQDSWPDIQTRLLLVCT
EALSYFISLTSESHREAWNSLLMLLLTRTLRLPDDKFKPHASCYYPHLCEMMQFDLIPEL
RAVLRRFFLRIGSVFQIAAPDGAHARTPVS
Download sequence
Identical sequences M4AQF7
XP_014326961.1.87360 ENSXMAP00000016702 ENSXMAP00000016702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]