SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018020 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018020
Domain Number 1 Region: 498-579
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000171
Family I set domains 0.036
Further Details:      
 
Domain Number 2 Region: 26-118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000223
Family I set domains 0.033
Further Details:      
 
Domain Number 3 Region: 400-478
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000157
Family I set domains 0.037
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000018020
Domain Number - Region: 131-241
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0306
Family C1 set domains (antibody constant domain-like) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018020   Gene: ENSXMAG00000017986   Transcript: ENSXMAT00000018047
Sequence length 690
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556748.1:1356688:1368836:1 gene:ENSXMAG00000017986 transcript:ENSXMAT00000018047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLPLFTSMLLFSWTTLNAALKITKVDLSIEPSAAVYRDTNVALRCKAEVLTFGTEALN
RVYTIYKGDSVIYNKTTSSSEDLLYHLPQARVSNNGKYKCKISIMGEEKASEAATLTVEG
MSTPILRFNKANITEGESVTATCLALGETGSLLFSFYDNSKEVENARVTSNELTFVPKGV
GNHIIHCSYLVFVMPNSFKSQTSNTVTLTVEELSIEPVLKISPQDNVYEGDTVNITCSVS
NVTKDYQAGELLLSQDTELLKSGKTSIHVNWTAHARTPMLTIKCRLYLRDVVKVVNKTIS
VSELFSVPTLKISALEVFQEDEISLTCRSEKLSYDRLEGEFFIYSLEPFDYHMVHKGNGV
FIGKAKTIDFNYTCTVAAKGIKKKSKVLTIHPKVPVSTPKIWVSGSAILGRKVEIFCLSD
TGTPPITYTLWKANKQNQIAIVHEFNKAANFTIVINEPGRLNHYLCKASNGNRTPEQSDK
LQTAVIEPMTEAYLMVVPDVDDISEGHTVILICSFLGTPPVTVRWLRDSDDLNPLKTTTT
NINTTSYEFVVNKEHTDNYYCQAENRANSVESNKINLVVGMAMWKKLLIPGTIILVVSSL
VMVGFILFTRSRRGKRERAAELSVKPASPKSDDSLTVTLTHDTEVYNAATDAASFCDDKE
GRVTNGTRGSVASLPADISNRSSYSIPATV
Download sequence
Identical sequences M4AU75
ENSXMAP00000018020 ENSXMAP00000018020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]