SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018259 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018259
Domain Number 1 Region: 542-588
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 2 Region: 57-104
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000327
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 120-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000353
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 497-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000026
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018259   Gene: ENSXMAG00000018193   Transcript: ENSXMAT00000018286
Sequence length 589
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557008.1:57942:64756:-1 gene:ENSXMAG00000018193 transcript:ENSXMAT00000018286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSVMMQPSRFSSHSCLLALTLSLVLLSEFPRTAASDENASVRETRSVGNRVVVQPVDCI
LSEWSRWSRCDTCTKKKYRYAKLEQPSQFGGEPCYLHGAQEERCEVPARYTCDSVPLCEG
FLCTQTTSRCVHRTLQCNGEDDCGDMSDEVGCTKTSKPCRVEAEEYWGIENLAKGINVLN
SHLEGVVLDNRYYGGGCLPHYIQDVPFRKPFNLQQYTLQTRGSYDFTLQSFESYSDYMDH
TFRERMTQTSFSIGFSVPGVFSFGFNYDSSKYSKSVSKIRRASGVTNSFIRAKAELELAQ
YILKSDGLVLHPEFLQRLRSLPQAYVYGEYRQIYKDYGTHYITEAALGGDFEHTTILNKE
KLEKSDYNLDQYKSCLQIGFKIGVTIEGVPVSLGLGGGSCSGLLNEMGEDTKNGAMVEDF
VAVVRGGNSESITALLSQKLPSEQLMRLWGEGVRYNPDFIRMTTKPLYELVTSRDFVQAD
SLKRNLKGALSEYLAETSACRCAPCHNNGVAVLKGTRCECVCPTGYTGRSCEITSRQKVL
GIDGGWSCWGAWSSCSGGQMTRSRQCSNPAPSSGGLPCRGLQQESTECF
Download sequence
Identical sequences M4AUW4
ENSXMAP00000018259 ENSXMAP00000018259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]