SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018633 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018633
Domain Number 1 Region: 347-479
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000267
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 462-592
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000267
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 3 Region: 317-359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000131
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018633   Gene: ENSXMAG00000018594   Transcript: ENSXMAT00000018661
Sequence length 753
Comment pep:novel scaffold:Xipmac4.4.2:JH556872.1:663257:721404:1 gene:ENSXMAG00000018594 transcript:ENSXMAT00000018661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTRAHGRTPMDPGSGGVKLLRTRLHLLRAVILLAVLTLQPRAVRAAGMFELQIRHFHN
PHGLLQAGDCCDLQAGGGGQRCSARDQCDTFFHACLKEYQARVAPTGTCTFGSGTTGVLG
GNSLSLRHRGHEPGGGEDGTNGHISIHFKYAWPKSFSLVLEALDHDNDTTEPGQLIERVL
LSSMLNPGEQWQTYRHHGRILGLEYRLRFRCDSNYYGPYCNKFCRARDDFFGHFSCDPSG
SKVCMEGWTGPECKEAVCRQGCHQTHGSCTVPGECKCHYGWTGSLCDQCVTFPGCVYGSC
AEPWQCVCDVNWGGLLCDKDLNYCGTHQPCLNGGTCTNTEPNEYQCECQEGFRGRSCDIV
EHACLSSPCANGATCVEDPNGFSCVCSEGWTGNTCADAVRQCDRNPCGRGATCQEAPGSF
RCLCPPGWTGRTCQLDANECETSTCVHARSCRNLIGSYLCDCLPGWTGPNCDIRNSSCQD
LCLNGGHCEDLVSGSTCVCPTGFTGKYCQNGLGPCDSNPCLHGGQCVATEGETATCDCPL
GYSGNSCEIAFDPCNPNPCQQGVQCHSSEGRFMCACPDGYHGNECVSLRNPCVEQDCQGA
MSDTTHGGLSLYMILVGILALVTICGCVVCTVVFSYLHRKRKKQQSVPQEEGINNQREFV
NLIRNVDRPPGPSQPPAAATNTAPHLHPHPHPPAQAPVSRCCEEIELTLPPSPAPSHPSP
ALKPAHAPKLDISNREREKLNRFHCTDNQELEV
Download sequence
Identical sequences M4AVY8
ENSXMAP00000018633 ENSXMAP00000018633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]