SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000019304 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000019304
Domain Number 1 Region: 617-902
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-82
Family Protein kinases, catalytic subunit 0.00000000144
Further Details:      
 
Domain Number 2 Region: 34-205
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-70
Family Ephrin receptor ligand binding domain 0.00000137
Further Details:      
 
Domain Number 3 Region: 331-539
Classification Level Classification E-value
Superfamily Fibronectin type III 1.68e-39
Family Fibronectin type III 0.00018
Further Details:      
 
Domain Number 4 Region: 924-983
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000335
Family SAM (sterile alpha motif) domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000019304
Domain Number - Region: 262-323,369-384
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00034
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000019304   Gene: ENSXMAG00000019246   Transcript: ENSXMAT00000019332
Sequence length 999
Comment pep:novel scaffold:Xipmac4.4.2:JH556675.1:2280456:2309276:1 gene:ENSXMAG00000019246 transcript:ENSXMAT00000019332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAGVVAKINFCSLFMKCQKIKTIYMCVCVSAIPVTLLDTRTVPGELKWAANPAEGGWEEV
SIMDEKNIPIRTYQVCNVLEPSQNNWLRTDWIPRSGAQRVYVEVKFTLRDCNSLPGVTGT
CKETFNLYYHESNEDRESYIKESSFIKVDTVAADESFTQVDVGDRIMKLNTEIRDVKVTT
RKGFYLAFQDVGACIALVSVRVFYKTCPLTVRNLATFPDTVTGADTSSLVEVRGSCVNQS
EEREEPKMYCGADGEWLVPIGGCFCKPGYEEQGGACKACSAGFYKSKSSDPGCSKCPPHS
RSLRDGANICDCHTGFFRADFDPPSMACTQPPSAPQQLISVVNETSVVLEWAPPRRLGGR
SDISYSLECLICQTGSTQLCLPCGSDVLFSPDQTGLQTTRMVVSRLRAHTHYTFIVYARN
GVSLVSGAGASQSASVSLTTNQAAPSPVSSIQLTDVTRHSLSLAWQQPDRPNGVILEYEV
KFYEKDQRERSYRIMRTFLRSVDVAGLNPLTVYVFHVRARTAAGYGEYSAPFEFSTNSDP
FPLIGEGVNSAFLLLSVSGVGVLLFISAAVFIISRRRSKYSKTKQDAEEEKHLNPGVKIY
VDPFTYEDPDQAIHEFAKEIDVNSIHIERVIGIGEFGEVCSGRLRSQGKREIYVAIKSLK
AGYSDKQRRDFLSEASIMGQFDHPNIIRLEGVVTRCKPLMIITEYMENGSLDAFLRKHDG
QFTVIQLVGMLRGIASGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPE
AAYTTREATGSYLSPGGKIPIRWTAPEAISYRKFTTASDVWSYGIVMWEVVSYGERPYWD
MNNQDVIKAIEEGYRLPAPMDCPVVLHQLMLDCWERERGDRPSFSQILNMLDKLIRNPGT
LRRTGGDRVGSEVCVSVVPEVCVPPWSMYDWLQSIGLERYRDVLAAAGYSSLESLLTLTH
QEMDRLGIITPSHQDILIASVQQEMLSQMQHMQHSMVPV
Download sequence
Identical sequences M4AXV9
ENSXMAP00000019304 ENSXMAP00000019304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]