SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397678816|ref|YP_006520351.1| from Mycobacterium massiliense str. GO 06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397678816|ref|YP_006520351.1|
Domain Number 1 Region: 37-221
Classification Level Classification E-value
Superfamily Leukocidin-like 5.49e-66
Family Porin MspA 0.000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397678816|ref|YP_006520351.1|
Sequence length 222
Comment porin MspB [Mycobacterium abscessus subsp. bolletii str. GO 06]
Sequence
MRTVGIRRVVQSTLTSLILVVGMVGLTVIGTGTAHAGLDDELTLVDGKGRLLRIQQWDTF
LNGVFPLDRNRLTREWFHSGRAXYEVTGPGSDAFEGTLELGYQVGYPWSLGVGLNFNYTT
PNTSILYGIPNAFGGSPEASYVQTTNLLPSAGINVDLGNGPGIQEVATFSVAVAGPKGAV
AVSNAHGTVTGAAGGVLLRPYARLISSAGDSVTTYGETWDMK
Download sequence
Identical sequences gi|397678816|ref|YP_006520351.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]