SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397680551|ref|YP_006522086.1| from Mycobacterium massiliense str. GO 06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397680551|ref|YP_006522086.1|
Domain Number 1 Region: 136-414
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-44
Family Protein kinases, catalytic subunit 0.00082
Further Details:      
 
Domain Number 2 Region: 506-638
Classification Level Classification E-value
Superfamily TPR-like 0.000000057
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397680551|ref|YP_006522086.1|
Sequence length 753
Comment serine/threonine-protein kinase pknG [Mycobacterium abscessus subsp. bolletii str. GO 06]
Sequence
MSEDPEEPDDTSADEGPGTQPASLADLDVDSASTMRPISTRAVFRPPDSTQPATQPTTQP
EVRATTTRVLLSPTRRLGGGLVEIPRVPEIDPLEALMTNPVVEESKRFCWNCGKPVGRST
TDSPAQSEGICPSCGSSFSFLPQLNPGDVIAGQYAIKGCIAHGGLGWIYLAVDRNVNDRP
VVLKGLVHSGDAEAQNIAMAERRFLAEVAHPSIVKIFNFVEHPDQHGNPVGYIVMEYVGG
TSLKQPKGSALPVAQAIAYMLEILPALGFLHSVGLTYNDLKPENIMITEEQLKLIDLGAV
ASINAYGNLYGTPGYQAPEISKTGPTVASDIYTVGRTLAVLTLRMPTRKGRYKDGLPSED
PVLAKYDSYHRFLRRAIDPDPSARFGSAEEMATQLVGVLREVVALDSGTPRPGMSTLFSP
SRSTFGVDLLVAHTDVYVDGLAHPPSLTAPDIVTALQVPLLDPTDVGAAILQATVLSQPI
QTLESLKAARLGRIDADGVDLTESVELPLMEARALLDLGDVAKANSKLDQLEDRVGTPWR
LTWYRGMAALLNGDYDQATKHFTTVLDFLPGEIAPKMALAATAELAGDEKNLDFYRTVWS
TDNSVISAGYGLARTLAARGERAEAVRMLDNVPPTSRHFTTARLTSAVTLLSGRTLSEVT
EDDIREAARRVEALPETEPRVLQIRALVLGTALDWIKSNHSTGHHILGVPFTKRGLRQGV
ERCLRALARRATERAHRYALVDLANATRPTSLL
Download sequence
Identical sequences gi|397680551|ref|YP_006522086.1| WP_005062412.1.10031 WP_005062412.1.100779 WP_005062412.1.101432 WP_005062412.1.101662 WP_005062412.1.10342 WP_005062412.1.10602 WP_005062412.1.10730 WP_005062412.1.11888 WP_005062412.1.125 WP_005062412.1.12850 WP_005062412.1.13439 WP_005062412.1.13518 WP_005062412.1.13703 WP_005062412.1.13789 WP_005062412.1.13890 WP_005062412.1.13978 WP_005062412.1.14802 WP_005062412.1.15406 WP_005062412.1.16250 WP_005062412.1.16991 WP_005062412.1.17023 WP_005062412.1.17246 WP_005062412.1.17823 WP_005062412.1.18667 WP_005062412.1.19143 WP_005062412.1.19257 WP_005062412.1.19356 WP_005062412.1.19500 WP_005062412.1.19688 WP_005062412.1.19799 WP_005062412.1.19932 WP_005062412.1.20033 WP_005062412.1.20137 WP_005062412.1.20903 WP_005062412.1.22055 WP_005062412.1.22116 WP_005062412.1.2268 WP_005062412.1.22795 WP_005062412.1.22807 WP_005062412.1.23296 WP_005062412.1.2360 WP_005062412.1.23874 WP_005062412.1.23947 WP_005062412.1.2412 WP_005062412.1.2448 WP_005062412.1.24564 WP_005062412.1.24973 WP_005062412.1.2523 WP_005062412.1.25468 WP_005062412.1.25535 WP_005062412.1.25653 WP_005062412.1.25672 WP_005062412.1.25900 WP_005062412.1.2646 WP_005062412.1.26996 WP_005062412.1.27784 WP_005062412.1.27895 WP_005062412.1.28286 WP_005062412.1.2898 WP_005062412.1.30071 WP_005062412.1.30449 WP_005062412.1.30577 WP_005062412.1.31118 WP_005062412.1.31258 WP_005062412.1.31415 WP_005062412.1.31687 WP_005062412.1.32026 WP_005062412.1.32766 WP_005062412.1.33411 WP_005062412.1.33548 WP_005062412.1.33568 WP_005062412.1.33672 WP_005062412.1.33721 WP_005062412.1.34087 WP_005062412.1.34095 WP_005062412.1.34518 WP_005062412.1.34725 WP_005062412.1.35041 WP_005062412.1.35808 WP_005062412.1.3587 WP_005062412.1.3631 WP_005062412.1.36452 WP_005062412.1.36744 WP_005062412.1.36855 WP_005062412.1.36924 WP_005062412.1.37017 WP_005062412.1.37349 WP_005062412.1.37402 WP_005062412.1.37768 WP_005062412.1.37785 WP_005062412.1.37928 WP_005062412.1.38298 WP_005062412.1.38954 WP_005062412.1.39187 WP_005062412.1.3946 WP_005062412.1.39574 WP_005062412.1.39612 WP_005062412.1.3969 WP_005062412.1.39744 WP_005062412.1.39885 WP_005062412.1.40222 WP_005062412.1.41056 WP_005062412.1.41691 WP_005062412.1.42039 WP_005062412.1.42175 WP_005062412.1.42186 WP_005062412.1.42875 WP_005062412.1.42895 WP_005062412.1.43004 WP_005062412.1.43117 WP_005062412.1.43171 WP_005062412.1.43365 WP_005062412.1.43397 WP_005062412.1.43631 WP_005062412.1.45085 WP_005062412.1.45194 WP_005062412.1.45677 WP_005062412.1.45824 WP_005062412.1.46142 WP_005062412.1.46265 WP_005062412.1.46390 WP_005062412.1.46844 WP_005062412.1.46960 WP_005062412.1.47324 WP_005062412.1.47418 WP_005062412.1.47757 WP_005062412.1.47915 WP_005062412.1.4793 WP_005062412.1.48079 WP_005062412.1.48159 WP_005062412.1.4828 WP_005062412.1.48302 WP_005062412.1.48458 WP_005062412.1.48640 WP_005062412.1.48895 WP_005062412.1.48914 WP_005062412.1.4893 WP_005062412.1.49292 WP_005062412.1.4954 WP_005062412.1.50402 WP_005062412.1.50620 WP_005062412.1.50855 WP_005062412.1.51595 WP_005062412.1.51604 WP_005062412.1.52476 WP_005062412.1.5254 WP_005062412.1.52636 WP_005062412.1.5267 WP_005062412.1.528 WP_005062412.1.53120 WP_005062412.1.53358 WP_005062412.1.53468 WP_005062412.1.53765 WP_005062412.1.54149 WP_005062412.1.54326 WP_005062412.1.55601 WP_005062412.1.56143 WP_005062412.1.56609 WP_005062412.1.56938 WP_005062412.1.5792 WP_005062412.1.57967 WP_005062412.1.58256 WP_005062412.1.58716 WP_005062412.1.59544 WP_005062412.1.59946 WP_005062412.1.59947 WP_005062412.1.60354 WP_005062412.1.60456 WP_005062412.1.61063 WP_005062412.1.61125 WP_005062412.1.62556 WP_005062412.1.62827 WP_005062412.1.63790 WP_005062412.1.63861 WP_005062412.1.63965 WP_005062412.1.65216 WP_005062412.1.65615 WP_005062412.1.65825 WP_005062412.1.66000 WP_005062412.1.67337 WP_005062412.1.67485 WP_005062412.1.68014 WP_005062412.1.68035 WP_005062412.1.68198 WP_005062412.1.68419 WP_005062412.1.68968 WP_005062412.1.69075 WP_005062412.1.69092 WP_005062412.1.69956 WP_005062412.1.7004 WP_005062412.1.70111 WP_005062412.1.70212 WP_005062412.1.70925 WP_005062412.1.71152 WP_005062412.1.71190 WP_005062412.1.71374 WP_005062412.1.72320 WP_005062412.1.72851 WP_005062412.1.73632 WP_005062412.1.74063 WP_005062412.1.7414 WP_005062412.1.74413 WP_005062412.1.74493 WP_005062412.1.74505 WP_005062412.1.74662 WP_005062412.1.75495 WP_005062412.1.76353 WP_005062412.1.76789 WP_005062412.1.76842 WP_005062412.1.76870 WP_005062412.1.76949 WP_005062412.1.77270 WP_005062412.1.78055 WP_005062412.1.78213 WP_005062412.1.78391 WP_005062412.1.78665 WP_005062412.1.7922 WP_005062412.1.79843 WP_005062412.1.80323 WP_005062412.1.80912 WP_005062412.1.81450 WP_005062412.1.81953 WP_005062412.1.82204 WP_005062412.1.8231 WP_005062412.1.82849 WP_005062412.1.82852 WP_005062412.1.83488 WP_005062412.1.83521 WP_005062412.1.83610 WP_005062412.1.84018 WP_005062412.1.84094 WP_005062412.1.84239 WP_005062412.1.84296 WP_005062412.1.84400 WP_005062412.1.84574 WP_005062412.1.84788 WP_005062412.1.84798 WP_005062412.1.85006 WP_005062412.1.85046 WP_005062412.1.85626 WP_005062412.1.8604 WP_005062412.1.86491 WP_005062412.1.86521 WP_005062412.1.86938 WP_005062412.1.87124 WP_005062412.1.88010 WP_005062412.1.88188 WP_005062412.1.88721 WP_005062412.1.89104 WP_005062412.1.89581 WP_005062412.1.9000 WP_005062412.1.90753 WP_005062412.1.91136 WP_005062412.1.9116 WP_005062412.1.91517 WP_005062412.1.91677 WP_005062412.1.91727 WP_005062412.1.91945 WP_005062412.1.9201 WP_005062412.1.92366 WP_005062412.1.92514 WP_005062412.1.92709 WP_005062412.1.92927 WP_005062412.1.93120 WP_005062412.1.9425 WP_005062412.1.94472 WP_005062412.1.94485 WP_005062412.1.94627 WP_005062412.1.94706 WP_005062412.1.94757 WP_005062412.1.94937 WP_005062412.1.9507 WP_005062412.1.95766 WP_005062412.1.96196 WP_005062412.1.96459 WP_005062412.1.96599 WP_005062412.1.96630 WP_005062412.1.97105 WP_005062412.1.97572 WP_005062412.1.98269 WP_005062412.1.9871 WP_005062412.1.98878 WP_005062412.1.99112 WP_005062412.1.99141 WP_005062412.1.99848 WP_005062412.1.99957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]