SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000256 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000256
Domain Number 1 Region: 58-272
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-51
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000000256
Domain Number - Region: 306-368
Classification Level Classification E-value
Superfamily PH domain-like 0.00984
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000256   Gene: ENSXMAG00000000262   Transcript: ENSXMAT00000000258
Sequence length 474
Comment pep:novel scaffold:Xipmac4.4.2:JH556812.1:21:10476:-1 gene:ENSXMAG00000000262 transcript:ENSXMAT00000000258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKLVKAAKEGTKDGLEKTKAAVKRGRSFIKKRKLACFEDESEVFIEVDCFNVEPVLPPT
PEGLTQQQLVRRCILGSILDSEKNYLDALKRILEQYEKPLSQIEPRLLSDRKLKIIFYRV
REILQCHFLFQIALASRVSEWDSLEMIGDVFVASFSKSMVLDAYSEYVNNFSTAMAVVRK
TCASKPGFLEFLKHRQESSSDRMTLYGLMMKPIQRFPQFILLLQDMLKNTPVGHADRLPL
QMALTELETLAEKLNEKKREADQRCEIRHIAKAMNERYLNKLLSNGSRYLIRSDDMVETV
YNERGEIIKTKERRLFLLNDVLMCATPNIRCQDGSGSGSGNAPLDQKFLLKWSVPLNFVE
VLEFGSSEEMVDNSRYPAPHSGEKVVINAKPIIDKLYMGPGQLYQDLQNLIHDLGLVNQI
AGMIGSLKGNYQNVNSTVAQDWVSGLQRLILKKEEEIRAADRCRIQLQLPGKND
Download sequence
Identical sequences M3ZDG4
ENSXMAP00000000256 ENSXMAP00000000256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]