SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000309 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000309
Domain Number 1 Region: 104-312
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-56
Family DBL homology domain (DH-domain) 0.0000537
Further Details:      
 
Domain Number 2 Region: 324-449
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000184
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000309   Gene: ENSXMAG00000000311   Transcript: ENSXMAT00000000311
Sequence length 450
Comment pep:novel scaffold:Xipmac4.4.2:JH556888.1:745065:762934:1 gene:ENSXMAG00000000311 transcript:ENSXMAT00000000311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGCCLFVYYRKKRKQTIRDADALSLCSLDINEPGTKRSKPVPRVAALASLLPPVKATSL
KRIGQTLQRSVGFRNESRASTLPPPPPPPSSSSSASKRRDSKLWSETFDVRVGATLSPKE
IKRQEAIFELAQGEQDLVEDLKLAKKAYRDPMLTLAIMTEQELNQIFGTLDSLIPLHEDL
LSRLRDARKPDGTTENVGHILTGWLPCLSSYTPYCSNQVQAKALLDQKKQDRRVQDFLQR
CLQSPFSRKLDLWNFLDIPRSRLVKYPLLLREILKHTPNDHLDRQHLEEAMLVVQSVVAD
INRRTGESECQHYKDRLLYSEEGRRDELIDGSKTLSCHGELKNNRGIKLHVFLFQDILVI
TRSVLLNSQPVSYQLCRQPIPIRQLDLEDVSDGELRVGGSIRGAFSNTERTKNFFRVSCR
SGSQLQTHCFQASDAFNKQQWINCIRQAKE
Download sequence
Identical sequences M3ZDL7
ENSXMAP00000000309 ENSXMAP00000000309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]