SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000415 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000415
Domain Number 1 Region: 498-687
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.98e-52
Family DBL homology domain (DH-domain) 0.000000265
Further Details:      
 
Domain Number 2 Region: 694-815
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-30
Family Pleckstrin-homology domain (PH domain) 0.0000271
Further Details:      
 
Domain Number 3 Region: 185-323
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000288
Family Spectrin repeat 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000000415
Domain Number - Region: 330-425
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0705
Family Spectrin repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000415   Gene: ENSXMAG00000000404   Transcript: ENSXMAT00000000417
Sequence length 819
Comment pep:novel scaffold:Xipmac4.4.2:JH556812.1:812447:830648:1 gene:ENSXMAG00000000404 transcript:ENSXMAT00000000417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESNMRWGFPRLRRAATSFPGNLHLVLVLRPTSLLSSTPSPSSSTDLGFRFSQDDFLLK
MPVVMLRSVGDLLRYIDENHLASDFTAKVEYCQSDWVLLRSSIETFAVTVKEIAQLLQGF
GSELSETELPDEANAIEFLLHSHSHRYRQMKDDIRGVLKEGRLLLSNLETVKAAKREAEE
EREIQADMETVQRLLAQLRDMEEAFDGFFEKHHLKLQQYLQLLHYESSFQQMDEVLERIS
AQEKEIACVGTTVVQTEQLLKDLDSLDKRAQEEMNRAQVVILHGHQLAANHHYALALIVQ
RCNELRHHCDVISTAVRTKRASLTRTRDLLRRLEEALRWCDEGAYLLASQMVDKFQTKEG
AQEALQYLSSHQERAPSVVKNTQDTLSLEFEAVLTPQLQSQITMVKEKLSSVQCMIRNRE
QCLKKLADVQVRPIQLVAPRPEPDQTVLRCKSPLFSPKHGKRASRRNNSPRKIEVMHDYQ
GNRSCLYGPNPETDSEAEDNSEQVTRHIMKELIATERIYVDELLSVLLGYRAEMEDPSTS
YLLPSALRCQKDVLFGNMPEIYQFHSRIFLHDLQGCLETPERVGACFLQRKDKFQVYERY
CQNKPCSELLWRQCSDSPFFQECQKKLDHKLGLDSYLLKPIQRLTKYQLLLKELLKHCVE
EHYRCELQEALDSMLELLKSVNDSMHQIAITGYPGDISQLGRIILQGNFSVWISHKRAAV
RMKELARFKPMQRHLFLYDHALLFCKRRDEDSQDSFYSFKSCLRMSTVAITETVKGDVKK
FEICYSGREVVYLVQAPTVEVKVAWLNEIQKILANPQKL
Download sequence
Identical sequences M3ZDX3
ENSXMAP00000000415 ENSXMAP00000000415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]