SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000541 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000541
Domain Number 1 Region: 21-256
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-52
Family DBL homology domain (DH-domain) 0.0000306
Further Details:      
 
Domain Number 2 Region: 253-382
Classification Level Classification E-value
Superfamily PH domain-like 1.93e-36
Family Pleckstrin-homology domain (PH domain) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000541   Gene: ENSXMAG00000000544   Transcript: ENSXMAT00000000543
Sequence length 936
Comment pep:novel scaffold:Xipmac4.4.2:JH556820.1:614235:626075:-1 gene:ENSXMAG00000000544 transcript:ENSXMAT00000000543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSHYAELQADLESDSCGLEAESWSSAVDQNYLMSLNKEAVKRQDVIYELIQTEMNHVRTL
KILLHIYMYELKQFHVIVWLEKLFPGLEVLLSLHHFFLNSLKSRQFESADEDNRNNYCIT
QLADILINQFSGSLGKQMTEGYGYFCSHHSEAVNFYKKQMQNNKKLQILIRKIDQLPLVR
RLTIPECFLLVTQRITKYPVLLERIIQNTDADTEEHRQLEKALELIKHTISQVNTKVSEC
EKTARVREIIRRLEQKSQVKLKDGRWFRREDLLQGNKTLLHEGPLIWKSSGKQKEIHAVL
LSDMLLLLQEKDQKLVFAAMDSKPPVIYLQRVIVREVAQEERGMYVICTWPSGSPEMYEL
YTSSKEECKTWMDLIRDVVESCRDNEVHREIITKLHMYQDKLQKRDELIKKSLEKKQDIF
AELYNDVVGQKTPHGGLLLRGDASDLQQGEALLSGAIEEVEKLQNLLFMTIKHPDTPEGE
TETQQSVRRAETFKGSLDNLVAKSMKCKFVFSKVAMMLRPKQLVYNVPEMHPSVCNVLSD
EDAAEKAQRRYSSCDHLLKNMSISEDLENLRLLAQKLYSLQAVIAQQDSRIELQKLFESK
SKLPVRSNTDTLLEKEKERNLEKQKEELAKLHKQQVQHQAEQQHWEKEREKQQVLIDSQN
AELQQREEECRKTEEKLKEKELELRQIRETYQQDLERLRETTQKLERDREVVNRDKERLE
KMKAKLANHYDDPTRTPALSTFSSFRSSIVNGAGTLTPVPSALVFTGNSPDPAETPPRVP
PRSTSIRMSRQMLPVQLMSTTNQVQKPVEVQQKIPRKLAAEPKGKEKIKSKHSHKRAHSA
ANIDVTQVVPIRVTGKNGGSLKAQISTSPKLQGSISNLFSPPPSDTFRPPASGPNVKPSQ
SFITPKWNNVSSHPPPSPPPFPTGIRTTEQDNVIVL
Download sequence
Identical sequences M3ZE99
ENSXMAP00000000541 ENSXMAP00000000541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]