SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000576 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXMAP00000000576
Domain Number - Region: 70-92
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00981
Family CRAL/TRIO domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000576   Gene: ENSXMAG00000000583   Transcript: ENSXMAT00000000578
Sequence length 104
Comment pep:novel scaffold:Xipmac4.4.2:JH557486.1:17041:21482:-1 gene:ENSXMAG00000000583 transcript:ENSXMAT00000000578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVADLRQASPPTTRFITETLLLLEEHKRTVHSVYIIQPKRKDAAKLLLKLLVGSKSCEAR
LCLCQNILLKEIPELWNSIDRSQLPASLGGYFLYCHSSWVSFMK
Download sequence
Identical sequences M3ZED4
ENSXMAP00000000576 ENSXMAP00000000576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]