SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000803 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000803
Domain Number 1 Region: 482-594
Classification Level Classification E-value
Superfamily SH2 domain 7.4e-30
Family SH2 domain 0.0000026
Further Details:      
 
Domain Number 2 Region: 168-262
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.2e-29
Family Ras-binding domain, RBD 0.00015
Further Details:      
 
Domain Number 3 Region: 293-407
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000493
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000803   Gene: ENSXMAG00000000791   Transcript: ENSXMAT00000000806
Sequence length 598
Comment pep:novel scaffold:Xipmac4.4.2:JH557007.1:148811:199922:-1 gene:ENSXMAG00000000791 transcript:ENSXMAT00000000806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAGCPDYFLHHPNYQQDNIDRSSNHRQADLIRPSFQPSTNQSSPNHQDDDVDLEALVN
DMNSSLESLYSTCSGQQTEITPLLHNGQNACSQHHPHQPPSSSSANVDTPQTKLRRSQPM
HILAVRKLQEEEQQFRTSSLPAIPNPFPELCSPASSPVLSPGSLPPGESSSEKHIVKIFS
EDGMCKVVEIPADMTVRHLCQLLVYKSHCVDDNSWALVEHHPLLGLERCLEDHERVVQVQ
ASMSSDSRFLFRKNYAKYEFFRNPLTFFPDHMVAWCQENDHKIPPSQLLQNFLSPSTCPE
IQGYLYMKDVGRKSWKKVYMFLRRSGLYCSTRGTSKEPRYLQLLADLEDNSIFTVITGKK
QHGAPTDYTFCFKLNKAIGETKELRMLCAEDEQSRTCWMTAFRIFKYGIILYQNYKQRKA
LLSHFSAPVRSVSENSLVAMDFSGRIGRVIDNPIEAQSAALEEGHMWRKRNRMNALGSHS
PLHQSSLNSVIHIAQLWFYGRITREESHRIIHQQGQVDGLFLLRVSQSNPKAFVLTLCHH
QKIKHFQILPCEEDGQVFFSLDDGETKFTDLIQLVEFYQLNRGVLPCKLKHPCTVVAL
Download sequence
Identical sequences M3ZF11
ENSXMAP00000000803 ENSXMAP00000000803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]