SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000875 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000875
Domain Number 1 Region: 2781-3043
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.27e-69
Family Protein kinases, catalytic subunit 0.00000199
Further Details:      
 
Domain Number 2 Region: 1927-2123
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-52
Family DBL homology domain (DH-domain) 0.0000108
Further Details:      
 
Domain Number 3 Region: 1262-1440
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-50
Family DBL homology domain (DH-domain) 0.0000000112
Further Details:      
 
Domain Number 4 Region: 2125-2247
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-34
Family Pleckstrin-homology domain (PH domain) 0.0011
Further Details:      
 
Domain Number 5 Region: 1447-1566
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-33
Family Pleckstrin-homology domain (PH domain) 0.000000967
Further Details:      
 
Domain Number 6 Region: 2674-2770
Classification Level Classification E-value
Superfamily Immunoglobulin 3.39e-22
Family I set domains 0.0088
Further Details:      
 
Domain Number 7 Region: 1074-1213
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-20
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 8 Region: 278-415
Classification Level Classification E-value
Superfamily Spectrin repeat 3.96e-20
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 9 Region: 826-979
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-19
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 10 Region: 491-641
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-19
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 11 Region: 2541-2608
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000245
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 12 Region: 195-309
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000089
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 13 Region: 1612-1705
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000072
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 14 Region: 646-753
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000696
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 15 Region: 52-185
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000222
Family CRAL/TRIO domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000000875
Domain Number - Region: 420-534
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0113
Family Spectrin repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000875   Gene: ENSXMAG00000000815   Transcript: ENSXMAT00000000878
Sequence length 3090
Comment pep:novel scaffold:Xipmac4.4.2:JH557007.1:293242:367940:-1 gene:ENSXMAG00000000815 transcript:ENSXMAT00000000878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLDNHSWQYAQAGKTLIRLSGFHCNEDMKAIDVLPILKEKVAFLSVSEGGRDRRGGPI
LTFPARSNHDRIRPDDLRRLVAYLATIPNEEVARHGFTVIVDMRGSKWDSIKPLLKILQE
SFPSCIHVALIIKPDNFWQKQRTNFGSSKFEFETVMVSLEGLTKIVDPSQLTADFDGSLE
YNHDDWIEVRLSFETFASDAARALARLEELQETLSQRDLPRDLEGARRLMEEHAALKKRA
TKASIEELDTQGRRLLQRLQLQTAGVGGGSEADAHNLVAKVTALLDKLHGTRQNLQQLWH
MRKLKLDQCFQLRLFEQDAEKMFDWIMHNKGLFLTSYTEIGGNHQHAVELQTQHNHFAMN
CMNVYVNINRIMSVGNRLLESGHYASQQIQQISGQLEQEWKAFAAALDERSTLLEMSASF
HQKADQYMSKVEPWCKACGEGELPSELQDLEDTIHHHQGLYEHITTAYSEVSQDGKALLD
KLQRPLTPGSADSLMASANYSKAVHHVLDIIHEVLHHQRQLENIWQHRKVRLHQRLQLCV
FQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEA
AEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVAFHTHVKELWTWLEEL
QKELLDDVYAESVEAVQDLIKRFGQQQQTTLQATVNVIKEGEDLIQQLRDSAISSNKTPH
NSSMAHIESVLQQLDEAQGQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNEELS
KQMNDFDTEDLTLAEQRLQHHADKALTMNNLTFDVIHQGQELLQYVTEVQTSGVELLCDR
DVDMATRVQDLLEFLHEKQQELDLAAEQHRRHLEQCVQLRHLQAEVKQVLGWIRNGESML
NAGLITASSLQEAEQLQKEHEQFQHAIEKTHQSALQVQQKAEALLQANHYDMDMIRDCAE
KVADHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPN
SETDHVTPMVSKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMLSHVKAPETQVK
NILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLSTHTSTGS
SIHHTQELLKEHEDFQITAKQTKERVKLLIQLADGFCDKGHAHALEIKKWVSSVDKRYRD
FSLRMDKYRTSLETALGISSDSNKASKELQLDIIPATAPGSEVKLRDAAHELNEEKRKSA
RRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKEHIIFGNMQDLYEF
HHNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVNYCKNKPDSTQLILEHAGPYFDEIQQ
RHRLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKKANDAMHL
SMLEGFDGNIDSQGELILQESFQVWDPKTLIRKGRDRHLFLFEMSLVFSKEVKDSNGRSK
YLYKSKLFTSELGVTEHVEGDPCKFALWLGRTPTSDNKIVLKASSIENKQDWIKHIREVI
QERTVLLRGALKEPIHIPKATTAKHKGRRDGEDLDSQGDASSQPDTISIASRTSQNTLDS
DKLSGGCELTVVIHDFVASNGSSNGELTVRRGQTVEVLERLHDKPDWCLVRTTDRSPAQE
GIVPCSILCIAHSRSSMEMEGLFNHKDTLSVSSNDALQPGSSHTLGPHSSPGPKRPGNTL
RKWLTSPVRRLSSGKADGHVKKLAHKHKKNRDGTRKNMDAIPGSQKDSDDSAATPQDETL
EERMRNEGLSSGTLSKSSSSGMQSCGEEEGEEGADAVPLPPPMAIQQHSLLQSDSQDDKS
TSRLSARPSSSETPSAAELVSAIEELVKSKMSLEDRPSSLSVEQGDSTSPSLNPSDNSLL
SSSSPIDEMDERKTNFLKRRHYVLLELVETERDYVRDLGSVVEGYMSRMKEEGVPDDMRG
KDKMVFGNIHQIYDWHKDFFLGELEKCLEDPERLAALFVKQERRLHMYIVYCQNKPKSEH
IVSEYIDTYFEDLKQRLGHRLQITDLLIKPVQRIMKYQLLLKDLLKVSKKAGADTTELEK
AVEVMCVVPKRCNDMMNVGRLQGFDGKIVAQGRLLLQDTFMVSDQDGGLLSRMKERRVFL
FEQIVIFSEPLDKKKGFSTPGYLFKNSIKVSCLGLEENSDDPCKFTLISRSSSGNLERFT
LHSASPGVSQAWVHQVSQILENQRNFLNALTSPIEYQRNHVGGGGPPSSSNSSTGGSSTN
STSSMGGGGGGGGGGGGSGGSGGNSSSLCGPRSRPSRIPQPSSRLPQPVHHHHPPGPEGP
DRSAGMWSPSHPSLPSYPYSDSPTNGELLTSEVFTLKRLDSSQGSNYNNSNRPADNTDGG
LKQTFGVYEETQIHQKTAVPQMPVAPLSFSLRNPRVGTVSPLISPQTPGGGKEPFIPSSP
AHKGNPFWAVVPPMPPSPAGRPGSFSFPSDNSGGVDSLGRGIPPFLRNSSHSKETDRMST
CSSTSEQSVTSTQSNGSESSSSSSSVSTMLVTQDYVAVKEDEISVVQGEVVQMLASNQQN
MFLVYRAANEHSPAAEGWIPGYVLGHTSSSTTPDLPEGTIKKSLSWHTALRIRRKSEKRD
KDGRKLENGYRKSQDGLANKVSVKLLNPNFIYDAPPEFLIPLSDASCESGDSVTLRCKVC
GRPRATVSWRGPDNSILSNNGHYSVTYSETGEASLHVLRVSLEDNGVYTCVATNVAGTVT
SSAGLTVSAPNNGSEDIWKSSFESYFTEITELGRGRFSVTKRCDQRGSKRTIAAKHVNKK
LLCRDQVLQEIRLLQTLDHPNLVRLLDTYETAHSYVLVLEMADQGRFLDYIVSWGNLTEE
KVALYLRDILEALQYLHGWKVAHLDLKPENIVVEQVCSQPVIKLTDFGDAVQLDTHSSHI
HPLLGSPEFSAPELVLGQPVSLTSDLWSLGVVTYVLLSGASPFLDESLEETCLNICRLDF
SFPEDYFQGVSTEAKDFVCLLLQGELERRPSAGFCLQYPWLQPRGVASGGYGHLDTSRLI
SFIERRKHQNDVRPVGAIQAFLHSRLYNHT
Download sequence
Identical sequences M3ZF83
ENSXMAP00000000875 ENSXMAP00000000875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]