SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000941 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000941
Domain Number 1 Region: 599-762,791-826
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-45
Family DBL homology domain (DH-domain) 0.0000357
Further Details:      
 
Domain Number 2 Region: 824-942
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-32
Family Pleckstrin-homology domain (PH domain) 0.00061
Further Details:      
 
Domain Number 3 Region: 259-414
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000852
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 4 Region: 32-187
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000118
Family CRAL/TRIO domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000000941
Domain Number - Region: 189-296
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00144
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000941   Gene: ENSXMAG00000000940   Transcript: ENSXMAT00000000944
Sequence length 946
Comment pep:novel scaffold:Xipmac4.4.2:JH557235.1:55658:84304:1 gene:ENSXMAG00000000940 transcript:ENSXMAT00000000944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPAEGGGEAGQDGLATAGSGKAEAVRAVDVLTVLREKVAFVSGGRDKRGGPILTFPART
NHDRIKQEDLSRLVTYLSTVPSEDVRARGFTVVVDMRGSKWDSVKPVLRTLQESFSSNIH
TALLIKPDTFWQKHKTNLGSAKFSFEAVTRLCPQTSLVSVEGLSRLIDPSQLTADLGGSL
EYDHVEWTELRLGLEEFSGAATQLLAQLEQLEAGLNRIPEPKDVDEARKLLLKHMERRLA
MNNMIYEVIQQGHDLQQYITEVQASGMELSEAEGGLTAQVEELQRLLQDKQKELQQIADH
THTYLEQNLQLRHLQSQVKQLSQVLGWISEGEMKLSSCMLNSSCLSEAEQLQREHERLQQ
TIERTHQVALALQQRAELLVRSGHYDPDAVRACAQTVALHWQTLMLRIEDRLKLVNASAA
FYRTSQQALEWLQQSGDHYLATHTSPGATAAETQELLNQHREFCVSAKVVPETSLNSSRD
FYMMFSLTEKSCFCQIKQQKEINQRNDQIITKHSEERGLRKRAKTQTAWATPAASPTPSP
SRPGRRRTRPTATRYLNKALADESRPKTESRKSRRTEKAHNQNQEAGQQALDSDQGSNES
DTEQRNKALRGRMFVVNEMIQSEKDYVKDLGVIVEGFMSRLEVRGIPEDMRGKDKIVFGN
IQQIYDWHRDFFLVELERCVQNHDLLADLFIKHERRLHMYIVYCQNKPRSEFIVIEYETF
FEVISRLLDGNKPIIDYLIKPVQRITKYQLLLKDFLKYTTKAGLDCEEVEDGESSACGTA
LTFAIFNISLCVCVFCLQKAVELMSLVPKRCNDMMNLGRLQGYEGKLTSQGKLLQQETFC
VWEQDGGVLSRSKERRVFLFEHIVIFSELLRKGSNNPGYQFKNSIKVIYLAMQESVDGDP
CKFVLWSRGSAERFTLQASSASIKMTWAETIATLLDAQNNFLSGGN
Download sequence
Identical sequences M3ZFE9
ENSXMAP00000000941 ENSXMAP00000000941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]