SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001107 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001107
Domain Number 1 Region: 1103-1272
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.03e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000499
Further Details:      
 
Domain Number 2 Region: 542-745
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-45
Family DBL homology domain (DH-domain) 0.00058
Further Details:      
 
Domain Number 3 Region: 1-67
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 1.44e-32
Family Bcr-Abl oncoprotein oligomerization domain 0.0000303
Further Details:      
 
Domain Number 4 Region: 760-829,886-921
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000795
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 5 Region: 963-1089
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000064
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001107   Gene: ENSXMAG00000001050   Transcript: ENSXMAT00000001110
Sequence length 1324
Comment pep:novel scaffold:Xipmac4.4.2:JH556700.1:291991:362532:1 gene:ENSXMAG00000001050 transcript:ENSXMAT00000001110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEPVGFIEAWKAQFPDSEPPKMELRSIGGIEQELEKCKASIRRLEQEVNKERFRMIYLQ
TLLAKERKSYDKQRWGFRKPLGDGTGRSKPRPPPARKSASHGDGLESAFDSPQQAESTSC
DNLDGLSPSKQRGGITLSPRRPTLPPPDKDLPSDPKDKLGMGLGVAALRSNFERIKRANS
HSAGDEKQLPPPPPPFYTNMEFHHERGLVRVNDRDVSDKISSLGTQAMQMERKRSLHSLP
GNLATVAGELRARPVYRGRSTESTCGYDAEYEDGEPNQRHSGRANGGKPPPPPWQPSEFQ
AYSSVYVGGVMMGEGGSGDGRGGGSGIAMRDHSGGDDHLLTWPRRSYSPGSFEDAGGGGG
YTPDCSSNENLTSSEEDFSSGQSSHVSPSPTTAFRRPFREKSRSPSQNSQNSQHSYDSSS
PPTPQSQKRHHRQQGGHVVMSEATIVSVRKTGQIWPPPVHHDLLPHGRTSHDNSFHGDHL
DGHFTGTPPTYGYDADRAEEQRRHHDILPYIDDSPSSSPHLSSKSRSSRDTLSSGSLESS
KSMECDLEKGLEMRKWVLSGILATEEAYLSHLEALLLPMKPLKAAATTSQPVLTVAQIET
IFFKVPELYEIHKEFYDGLLPRVQQWSHHQRVGDLFQKLASQLGVYRAFLDNYELAVETA
EKCCQANSQFAEISENLKVRSPKDCKDTAKNSLEALLYKPVDRVTRSTLVLHDLLKHTPT
SHPDHPLLQDALRISQNFLSSINEETTSRRQSLAGKKGENRQLLKDSFMVELVEGTRKLR
HVFLFTDLLLCAKLKKQIGGKNQQYDCKWYIPLTELTFQGPEDTEPLTIPQVPDEELDAV
KVKISHLRSEIQREKRANKGSKVIDRLRKKLSEQESLLLLTSPSMPLRLFNKNGKSYSFL
ISSDYERSEWREIIREQQQKCVKTPSLTSMELQMLTSSCLKLQTVHNIPLSLNKEEDESS
GLYGFLNVIVHSASGLKQSLNLYCTLEVDSFGFFLNKAKTRVYRYTTEPKWNEEFEIELE
GSQTLRLLCYEKSYNRTKLNKEDGDSTDRIIGKGQILLDAQTLQGKDWQRTVIPMNGVEV
KLSMKFTSREFSLKRMPSEKPMGVFGVKISTVTKRERSKVPYIVRQCLEEIERRGMEEVG
IYRVSGVATDIQALKTAFDTNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDELYPN
FAGGITLTDSVAKESCMLNLLLSLPEPNLVTFLFLLDHLKRVAEKESVNKMSLHNLATVF
GPTLLRPAEKDSKIPSNPTQPISMGDSWSLEVMAQVQVLLYFLQLETIPTPDSKRQSILF
STEV
Download sequence
Identical sequences M3ZFW5
ENSXMAP00000001107 ENSXMAP00000001107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]