SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001269 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001269
Domain Number 1 Region: 15-176
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 4.08e-31
Family Glycosyl transferases group 1 0.077
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000001269
Domain Number - Region: 241-312
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0576
Family DBL homology domain (DH-domain) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001269   Gene: ENSXMAG00000001282   Transcript: ENSXMAT00000001272
Sequence length 338
Comment pep:novel scaffold:Xipmac4.4.2:JH556700.1:507072:515522:1 gene:ENSXMAG00000001282 transcript:ENSXMAT00000001272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRGLVVCILSGLLLCLHNGWWDANTYNYWKNTANVTILLWKWPFGRSYSLKGNVCWDLY
KIPNCLLVDQRSFFPSADVVVFHNRELIQGSQQLPTELPRPQGQRWAWMSLESPAHNGNL
KKFANIFNMTISYRRDADVTIPFGELLPLETESNLVEDSHINKTSLVCWVVSNYQRNNKS
IFIFCKLLIIIFLSFSFAKITWLNYKSLDVLPLINHTFFFIYLLNSFAIIYIKQKMMKNC
NMLGKVYTLPFQTYSWLLSVSLYMHIFNDFSNIHERNLYFSKILKSISKTGIVFHNRKVT
MLKRWRDWIEMLCKICLQYSSLPLHKVYSDLEAWDKEG
Download sequence
Identical sequences M3ZGC7
ENSXMAP00000001269 ENSXMAP00000001269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]