SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001475 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001475
Domain Number 1 Region: 408-628
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.55e-57
Family DBL homology domain (DH-domain) 0.0000535
Further Details:      
 
Domain Number 2 Region: 618-764
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000244
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 3 Region: 778-837
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000538
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001475   Gene: ENSXMAG00000001477   Transcript: ENSXMAT00000001478
Sequence length 858
Comment pep:novel scaffold:Xipmac4.4.2:JH556716.1:1269985:1307531:1 gene:ENSXMAG00000001477 transcript:ENSXMAT00000001478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLGNDVDLSNNNITPLWRRRTDLSEGPQDLNKLKPRPASYHVNGVTTADFPAGDDGRSF
TLSQPAQPLNANDMQRLTTNPLDLDLEKDHISSGTNTPSPETPTDNCSSHIHSPHSPNNY
HYELSSQSSASSSSSPGYGTLTPSHSSSSSIPSLSSLTSSDPPTPRSPSPADRGNSLQSQ
TTSPASSYDTLYASSSSSSFSTSPSLSPTASPSPTIVLSTNSPAALKMGTQQLIPKGLAC
GIRQTKAPPTGTQRLGLDHSKRAMKVLSMVEAGGYFSTGGGHTEEAEGENESPGALRRGL
RSTSYRRAVVSEVDNPRMDKTKSNKKSKVGQSIHELIMNIFGAIGHNKRKKLTSQRTFDS
EEEELYQNYQEKALHNDSDEDADSRGPKPDQGIVVQYRPIRTSWSQLSVVKKNGLADQLS
QEERKRQEAIFELISSEHSYLHSLEILIRMFKNSPELSEAMTKIEHHHLFSNILDVCEAS
KKFFKELEDRHQQSIVIDDISDIVCKHAESTFDPYIKYCSNEVYQQRTLQRLVGAKNSAF
KEVLTRLEGHPDCRSLPMISFLILPMQRITRLPLLLDTICQKTSKDSARYETCKKALQAV
SKVVRKCNEGARTMERTEMMYTISTQLEFKIKPFPLVSSSRWMVKRGELTAFVEDSGIFT
KRKSRHHVYFFLFNDVLIVTKKKGEDSHTVIDYALRDQIQVGSSQPEDVHLSPAKSPTIM
LSSRQVGANHLFRLCFRSNHSSEKVAMILGTELENERARWISALGQNDNDERRHDRTNVM
QVEVIRTYTAKQPDELSLQVADVVLVSQHVDGWYEGERLRDGEAGWFPAECGEAITCQAT
IERNMQRMDRLQGLETNV
Download sequence
Identical sequences M3ZGY3
ENSXMAP00000001475 ENSXMAP00000001475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]