SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001582 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001582
Domain Number 1 Region: 553-667
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000011
Family Second domain of FERM 0.0095
Further Details:      
 
Domain Number 2 Region: 132-213
Classification Level Classification E-value
Superfamily SH3-domain 0.0000139
Family SH3-domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000001582
Domain Number - Region: 317-448
Classification Level Classification E-value
Superfamily ARM repeat 0.0134
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001582   Gene: ENSXMAG00000001574   Transcript: ENSXMAT00000001585
Sequence length 752
Comment pep:novel scaffold:Xipmac4.4.2:JH558198.1:9843:30545:1 gene:ENSXMAG00000001574 transcript:ENSXMAT00000001585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFIANFNVGTNISTIQDDNMKKRIVIAARDNWKNYFSRLYPVTPQNGDAQVLGVSHRGIR
LLKVVKASGINPKHLKLLKSYSFAEVLSVNLEEADRVKLELKTENLVLQSTRAPQITAMI
EVFLKELIKDSGHMVALKSFVTDDKTLLSFSKGDIIKLQKMEGLQTELYSYCIFNIKYAY
STHAPTLNVALGWEFGSTGGRSGLFPKDITQPCAAPDYHWLHLDRRDDRRKSMRNSSREA
MNPSSVQGLQHTLSQSSQKGSNHELDNLSAMADFATKYFRYAQINMNDHIEEYQKAFKLV
KTIFVTLCQIKVPIQESLILFNDSEINDLAVECFISLVQFMGEITTQKNTTQADCLTHIL
LLGKEKEILRDEIYCQVIKQTTNNPTRRKSSCTFGWRLLSLITGFFPCSAILHPFVMQHL
QEICQDNEHPYQELAFVCLDNLQRSINFGGRRNIPSHVEMEAVLTGKTSQRIPIQLPGGV
EFPVKIRSFSVTVDVVTELCENMEIVEFSEVKEFSLIATRFQDGMVRPLHPEDYLFDFLL
DDGSISLSFRRVLWETPLSFRNELFVDFHYQQLLEEYLHGKIPHYGGGTSSVQQIAELAA
LQHLAQGLKSQLSLPELKEYLPLQDGLASKAEEIQLLCHDQLAAMQSLSPQNAKIQFIES
LRTLPLFGSNTFLAKKVSQHGCPSPCLISVNKEGVRFLHPKTQVLVFQIALAQLQAMRTI
RPKKAGKVPGVEIQYGNAAKPQKILIHLQQVK
Download sequence
Identical sequences M3ZH90
ENSXMAP00000001582 ENSXMAP00000001582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]