SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001758 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001758
Domain Number 1 Region: 246-466
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-55
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 608-668
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-16
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 3 Region: 467-589
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000413
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001758   Gene: ENSXMAG00000001754   Transcript: ENSXMAT00000001762
Sequence length 692
Comment pep:novel scaffold:Xipmac4.4.2:JH558043.1:11387:18557:-1 gene:ENSXMAG00000001754 transcript:ENSXMAT00000001762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHASQPQRRTSHGSLKEKSIREWTEQVKWFFSCPQGESVQSEPLQIIEDSESGAEEEEGG
IVETSLHPAGSFLPRSRQTDQERRRFSASELISRLQLSQRKNSFTLKLGKSLSARVASKD
KQNSKFNVLSLFAIDKCNSRHRSSGGSSDSGTYRVRKKSIEEDMSIPSSFPTSNRLSRFL
PSSILYQEYSDVAINREIQRQQGKDPGTEEEGLRDEGSDGTPSPSNLSPSSSFRSSRGSA
FALWQDIPDVRTSGQLDTFSNEERKLQEAKFELVTSEASYIRSLTIAVDHFMLSQELTEC
LGAQEKQWLFSKLPEVKDVSERFLQDLEHRLEKDILRFDVCDIVLDHCPALRRVYLPYVT
NQAYQEQTYQRLLQDNPRFPGILARLEEDPICQRLPLTSFLILPFQRITRLKMLVENILK
RTTPGSRDEDTATKAFNELKKIIKECNSSVQSMKRMEELIHLNKKINFEGKIFPLISQSR
WLVKHGELLEVDTQMMSISGSKLKLPTKPVYLHLFNDCLLLSRRKDTWKFMVFVHAKIGE
LKVKDLSQKLQGISGFIFHLQLCEGQQLKHQILLKSHTESGKQRWITAMFPSDPFEDIEQ
ASENDDISQVQCIKSYQAQEHDELTLEKADILQAKTITSDGWVEGIRLSDGERGWFPKTY
VEEITSRSARLRNLRENIRIKCVTQKLKDCPM
Download sequence
Identical sequences M3ZHR6
ENSXMAP00000001758 ENSXMAP00000001758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]