SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001786 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001786
Domain Number 1 Region: 70-272
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-52
Family DBL homology domain (DH-domain) 0.00000183
Further Details:      
 
Domain Number 2 Region: 259-426
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-34
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 3 Region: 543-644,722-748
Classification Level Classification E-value
Superfamily SH2 domain 5.69e-26
Family SH2 domain 0.00072
Further Details:      
 
Domain Number 4 Region: 670-750
Classification Level Classification E-value
Superfamily SH3-domain 1.77e-19
Family SH3-domain 0.00084
Further Details:      
 
Domain Number 5 Region: 456-526
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000249
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001786   Gene: ENSXMAG00000001756   Transcript: ENSXMAT00000001790
Sequence length 754
Comment pep:novel scaffold:Xipmac4.4.2:JH556700.1:2029176:2087476:1 gene:ENSXMAG00000001756 transcript:ENSXMAT00000001790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRPFPSEDTALNEDDVYRSLEELADEHDLGEDDIYDCVPCEDDGDDIYEDIIKVEVRQPM
IRYMQKMGMTEDDKRNCCLVEIQETEAKYYKTLEDIEKNYMIPLKHVLSLQEMEAIFVNL
EDIIRVHFALLRAIDLNMVSGGSGLGKIFLDFKERLLIYGQYCSHMENAQKTLDELIATR
EDVKIKVEECTMKVQEGKFKLQDLLVVPMQRVLKYHLLLKELLSHSTDRPERQQLKEALA
AMEDLAMYINEVKRDNETLKKICEFQSSIENLQVKLEEYGRPKIDGELKVSSIVNRTKQD
RYIFLFDKVVIVCKRKGYSYELKEIIELQLYKMSDDPMNNRDMKKSSGKMWSYGFYLIHL
QGKQGFQFFCKTEENKRKWMEQFEMAMSNIKPERATANQHNFQMHTFDKNTNCRACKMLL
RGIFYQGYYCSRCGTGAHKECLEVITICKISRVAPLSFSKLFPGPKMVAVRNYHGTPTPP
GKTPLCFQTGDFIELLKGDPDTPWWEGKLIQTQKSGFFPSSCVKPYLDPKSLSSRQSSRE
SDYYGYPWFAGNMERQQADNLLKSHCSGTYLIRERTAEAERFAISIKFNDEVKHIKVIEK
DNWIHITEAKKFESLLELVEYYQSHSLKESFKLLDTTLRYPYKSRERSLTRASTRSPAAT
CASYNFSFLSPQGLNFSSSQSSAPFWSVFTPRVVSTAVARYNFAARDMRELSLREGDVVK
IYSKIGGDQGWWKGEANGRIGWFPSTYVDEEGAQ
Download sequence
Identical sequences M3ZHU4
ENSXMAP00000001786 ENSXMAP00000001786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]