SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001883 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001883
Domain Number 1 Region: 844-1056
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.24e-43
Family DBL homology domain (DH-domain) 0.00078
Further Details:      
 
Domain Number 2 Region: 1211-1394
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-22
Family Pleckstrin-homology domain (PH domain) 0.00043
Further Details:      
 
Domain Number 3 Region: 1045-1164
Classification Level Classification E-value
Superfamily PH domain-like 1.77e-21
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001883   Gene: ENSXMAG00000001881   Transcript: ENSXMAT00000001888
Sequence length 1396
Comment pep:novel scaffold:Xipmac4.4.2:JH556702.1:1398759:1425598:-1 gene:ENSXMAG00000001881 transcript:ENSXMAT00000001888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTDCTQPSAVPTPRFVCHANLKLLSPLTSASRGPKPSVAPKPKVKVLINGNQGGFSNGS
AQSSDARSDKATVKQNGLNKVIMNASSGKKHLNLSSLKFDKRDLETISKGTVDSGGTEAE
KEEDESKNMDDCRLTDRALTEEGDSLKTLWVSDDRLTADSEEAEEITDTDDMDAEGCDGG
EALADADGLSMGDISASGEDRLFCHSIVTQEQIQTTGDRSTADDLSKSSDENGLCLKERM
MDTQGREKEPGPNWCCNSLKLMCGHQINGKGENQQEISLYDYIPKIHQQVCSEAIEPFYI
CSEDIINMTATLSESDSTSVKRTGVPAGKYNETPENGHLVDCMNTDKGIDYGKAKEMEDM
LNHLDCQPRFRQVAISVPTDTDTSLTSSFSESQLLSPNDSEVFKDDEDLEGHIVPFLDET
SDMELHITDEHVYEEPGQSSCTESGFLLDSKTAGIRTHSLSNYISTTVGDRGVQFLHKTY
ISGLGQPALSSSPVLNSTRHKSYSKPKYLSLYPRSLSMEGHNTPLCIYKDDSYRHRDGVS
SSESFSRCSPLSSSALSTPTSLMDIPPPFELAYITKKPITKSSPSLLTREEFSEKDRKKK
SSIKRFLLKFGWKTEHKSGTDAKSSSLKSSAESSHCSHNRLLAFDRQSMSGSPQLNLRQA
NKPQGSPESSSHFLFHTESKRKGNSVAFLNRSVVRVESFEDRSRVPFAPLPFTKPRSISF
PNTDTSDYENVPPLNSDYENVQMPQWRPIRQMPLTHFFDRPSRVLSSTNETDGYVDMKSL
PGFETKTHLPEEETESAYTEAYNVCSVAASARSDDRGETVGDEDQGRTSEEEDVGTDVNY
DRQSDGRSRAFYIVKELVDTERLHVKALRLLQKDFRKVVGSAVGDDGQPAMDDERLREIL
NELPDVYILHSKILTELESRIGHWEDSQRIADIFLSRKAEFLVFTTYIGHYDRSISLLED
GCRASPAFAAIVQKYEEQNPAGERVPLQRQLLQVIVRVAQYRLLLTDYLNNLSPDSKEYE
DTQAAVAIMSDIADQVNDSLKHGENLLRLINIAYSVHSPRDLIHPGRVFVKEGTLMKVSR
KSRQPRHLFLMNDVLLYTFPQQDGKYRLKNSLPLSGLKVSKPNIPNVENALKIEGSEIFI
VLSASSFLEREDWYYTLNRTVTEQARGSAASSGETRDRLWLTLGEKAPTLVPVSQVMMCM
NCTADFSLTVRRHHCHSCGRIVCRSCSRNRYPLKYMKDRMAKVCDHCYNELKKRGGEASE
LSAKCSPRLTRSSRPLSTVFQNIHPPNIWRHRKGTASFTQATVSEEGSISGTLQRSKTSK
KNWKRLWFLLKDKEKVASESLPLLGFTVKLPDKQGGDTEANIFQLYHQNTLYYTFKAEDN
FTAQRWVNAMEEATNL
Download sequence
Identical sequences M3ZI41
ENSXMAP00000001883 ENSXMAP00000001883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]