SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002025 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002025
Domain Number 1 Region: 2-170
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-45
Family DBL homology domain (DH-domain) 0.0000264
Further Details:      
 
Domain Number 2 Region: 159-226
Classification Level Classification E-value
Superfamily PH domain-like 4.74e-16
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002025   Gene: ENSXMAG00000002026   Transcript: ENSXMAT00000002030
Sequence length 269
Comment pep:novel scaffold:Xipmac4.4.2:JH556702.1:1628302:1632477:1 gene:ENSXMAG00000002026 transcript:ENSXMAT00000002030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVLTELIETERLYVEDLGLIVQGYMTMMANQGVPEDMRGKDRIVFGNIHQIYDWHKDYFL
GELEKCVNDPDSLAQLFIKHERRLHMYVVYCQNKPKSEHIVSEYIETYFEDLRQQLGHRL
QLNDLLIKPVQRIMKYQLLLKDFLKYYSKAGRDVEKLQGKITAQGKLLQQDTFSVSEQEG
NLVSRARERRVFLFELLVIFSEPIEKKKGFPLPGYTFKNSIKVNFVFCRKEHEVCRCATK
RLLVTNGSASPALPAVLQQLPALSAFTTT
Download sequence
Identical sequences M3ZII3
ENSXMAP00000002025 ENSXMAP00000002025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]