SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002113 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002113
Domain Number 1 Region: 224-368
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-41
Family Third domain of FERM 0.00038
Further Details:      
 
Domain Number 2 Region: 515-727
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-40
Family DBL homology domain (DH-domain) 0.0006
Further Details:      
 
Domain Number 3 Region: 866-1003
Classification Level Classification E-value
Superfamily PH domain-like 9.31e-32
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 4 Region: 713-837
Classification Level Classification E-value
Superfamily PH domain-like 3.85e-26
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 5 Region: 123-223
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-25
Family Second domain of FERM 0.00017
Further Details:      
 
Domain Number 6 Region: 43-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.62e-22
Family First domain of FERM 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002113   Gene: ENSXMAG00000002095   Transcript: ENSXMAT00000002118
Sequence length 1018
Comment pep:novel scaffold:Xipmac4.4.2:JH556934.1:512879:562158:-1 gene:ENSXMAG00000002095 transcript:ENSXMAT00000002118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELTERPSTAGQRLGAPESFGVSTLEPGMRPPVQPPGRQVSIRVQMLDDTQEVFQISQR
APGKVLFDLACVHLNLTEGDYFGLEYTDHRKMTVWLDLLKPALKQIRRPKNTILRFVVKF
FPPDHTQLMEELTRYLFALQIKRDLACGRLICNDTSASLMVSHIIQSEIGDFDETQSWQH
LLHNKYLPDQDAIRDKIVDCHRQHVGQTPAESDYQLLEIARRLEMYGVRLYPAKDREGSK
LSLTVAHTGVLVFQGYTKINAFNWSKIRKLSFKRKRFLIKLRADPSNSHHDTLEFAMASR
DCCKVFWKICVEYHAFFRLFEEPKPKPKPILFTRGSSFRFSGRTQKQIIDHLKDSELKKV
PFERKHSKVLSSSSMSPHSSSFRSQVPKESATSILLADRPDSAKANGTEEPPTNGFPDSA
LNSDPSRQNHNGAGQHLLNPDGSDSKESPQESPQLVPNGGGPGEDQERGVAGMADVCQIP
GGHPLSPLTSPLLIEAGYVRHDDEEEARRKKFPTDKAYFMAKELLTTERTFLKDLQVITE
FFQKAAGKDEAFPDTIKNLISSHYDPVYRFHQGFLKETEQRLAQWEGRSNAHIKGDYQRI
GDVLLKNVQGLRQLTVHLQKHSECLVELERACRSSRKVEAVCRDFEQQRVCYLPLYIFLL
RPLHRLLHYKLILERLCKHYPPTHNDFRDSRAALAEISETALQLQGIMMKMENFQKLLEL
RKDLTGVENLVTPGREFIRLGCLSKLSGKGLQQRMFFLFSDCLMYTSRGTTSSNQFKVHG
QLSLYGMTIRESEEEWGVPHSFTLFGQRQSVVVAASCAAEMERWVEDIRMAIDLAEQSSS
PNVELLSTSPPDTKPLEDAGAELESEEELCGSRSSLERQSHRGNTTVHVCWHRNTSVSMV
DFSVAVENQLSGNLLRKFKNSNGWQKLWVVFTNFSLFFYKSHQDEYPLASLPLLGYSVTV
PAESENIHKDYVFKLHFKSHMYYFRSESEYTFERWMEVIRSATCSASRPLLSSRKDLY
Download sequence
Identical sequences M3ZIS1
ENSXMAP00000002113 ENSXMAP00000002113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]