SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002803 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002803
Domain Number 1 Region: 106-251,292-467,500-611
Classification Level Classification E-value
Superfamily Ras GEF 1.44e-117
Family Ras GEF 0.0000922
Further Details:      
 
Domain Number 2 Region: 738-832
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.48e-40
Family Ras-binding domain, RBD 0.00000778
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002803   Gene: ENSXMAG00000002762   Transcript: ENSXMAT00000002808
Sequence length 863
Comment pep:novel scaffold:Xipmac4.4.2:JH556764.1:1181844:1210503:-1 gene:ENSXMAG00000002762 transcript:ENSXMAT00000002808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSPGMLTEAASVKPGQLLEMFDSSWKVRSIWDGVKLEVVEDRSPVVLHSFTHLDPDLPLV
ESSTQEIGEEAEEDAIFTITLRKMQLHQSASKGQRWLGVDTDSALSLYETCKVRTIKAGT
LERLVEYMVSAFRGKDSTYVTIFLCTYRSFATTKQVLDLLLNRYAKLQNFPAVSAHRVSQ
DDCTELRNTVSSILGAWLDQYSEDFWSPPNYECLHQLLAYLHLHFPGSDLERRARNLLAH
FHRRQQCEPDPDGMKAGQEKRGIYLFKMIKTDVDEQGLDQAQMDAAFFIKSSGEHIGCPF
ATQEESGFEDELPAFSFLSFDPIMVAEQFTLMDADLFKKVVPYHCLGGIWSQRDKKGKEH
LAPTIRATVAQFNSVTNCVITTCLSNPALKPNQRARLIERWIDVARECRILKNFSSLRAI
LSALQCNSIHRLKRTWDEVARESVRTFRELSEIFSDDNNYSLSRELLVKEGTSKFATLEI
NPKRAQRRHQQQRDLGVMQGTIPYLGTFLTDLVMMDTAMKDYTEGGLINFEKRRKEFEVI
AQIKLLQLASNNYSFTQESHFREWFAAVEKLSEAESYNLSCEIEPLSESASNTLRAKKNG
GIMKRWSDRQLTEAGCSGGAGSHSKSFDHSHYRPYQGGGGGGDSGDALSVTSVSSSGSDL
EDVNTSFLSDSPEGHERKFWECTSLSSLDTSGMGSSSGSASGSSSTSSSSVSSSTPLSAS
RSHKRSVSAVSNYSTLSLPLYNQQVDDCCIIRVSLDVENGNMYKSILVTSQDKTPAVIRK
AMIKHNLEREKTEDYELMQKISEDKELRIPDNANVFYAMNSTANYDFVLKKRGSARPVRA
KNVASSTLPRMKQKGLKIAKGIF
Download sequence
Identical sequences M3ZKR1
ENSXMAP00000002803 ENSXMAP00000002803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]