SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002931 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXMAP00000002931
Domain Number - Region: 37-94
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0209
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002931   Gene: ENSXMAG00000002931   Transcript: ENSXMAT00000002936
Sequence length 171
Comment pep:novel scaffold:Xipmac4.4.2:JH556778.1:1140421:1143684:-1 gene:ENSXMAG00000002931 transcript:ENSXMAT00000002936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVQVMFVVLFMFLATVESQKGGVSFWRDKVTLTCPQNGTWKNNMENKNALEPGETHEFH
FKGQAQYYCEYDNNEEEKIKYYFFVKGKACENCFEVDGFLFLLVILVDVIGTAVMMRIIY
ACTKRKHPNAPLQPPRTRRTRPQADQSSAYESLNPNTQSTETYSTVVHRTG
Download sequence
Identical sequences M3ZL39
ENSXMAP00000002931 ENSXMAP00000002931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]