SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002935 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002935
Domain Number 1 Region: 619-687,917-1254
Classification Level Classification E-value
Superfamily Ras GEF 9.02e-120
Family Ras GEF 0.0000175
Further Details:      
 
Domain Number 2 Region: 222-443
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.03e-45
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 3 Region: 23-128
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-19
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 
Domain Number 4 Region: 432-588
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000107
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002935   Gene: ENSXMAG00000002892   Transcript: ENSXMAT00000002940
Sequence length 1256
Comment pep:novel scaffold:Xipmac4.4.2:JH556685.1:1298710:1328611:1 gene:ENSXMAG00000002892 transcript:ENSXMAT00000002940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGVRLNDGHVTYLGLLAKKDGTRRGCLSKKSSDNTKWHTKWFALLQNMLFYFENESSS
RPSGLYLLEGCLCDRAPSPKPSLSAKECLEKQYYFTVNFTHENQKALELRTEDVKDCDEW
VAAISHASYRNLATEHESLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEISG
LLKDNEKIHASPAAAPTEDDSEIKKIKKVQSFLRGWICRRKWKTIIQDYIRSPHAESMRK
RNQVVFSMLDSEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHIERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEVLLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVVSLIDCTLMEEPEGTDDESKSDK
SGQDMEHLDFKIVVEPKDSQSFTIILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAFED
NSKVTVPQMIKSDSSLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFLSIDFL
NTFLHSYRVFTTADVVLDKLITIYKKPISAIPARSLELFFASSQNNKLLYGEAPSSPRAS
RKFSSPPPLAIAKNSSPNRRRKLSLNIPIITGGKALDLAALSCSSNGYASMYSTMSPFSK
TTLDINKLYVSSPITSKIPDEGEDKKDKVEDTSVCKQDLSVREESDNDQNQSDDGDPEAS
PTKSPTTPKNIKCKNSSEFSLFSYNNGMVMSSCRELDNNRSALSAASAFAIATAGANEGT
PTKEKYRRMSLASTGFPTDQRNGDKEFVIRRAATNRVLNVLRHWVSKHFPDFESNNELKT
KVIAFLEEVMHDPELLTQERKAAANIIRTLTQEDHSDNQITMEDVTQLVGGGKAEPFESH
SALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKNEKTPYIMRTTKHFNDTSNLIATEI
LRCDDLVTRVAVIEKWVAVADICRCLHNYNAVLEITSSLNRSSVFRLKKTWLKVSKQTKA
LIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDNLVNFSK
MRMISHIIREIRQFQQTAYKVDLQPKVAQYLLDKSFVLDEESMYEASLRIEPKVPN
Download sequence
Identical sequences M3ZL43
ENSXMAP00000002935 ENSXMAP00000002935 XP_005798273.1.87360 XP_005798274.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]