SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002936 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002936
Domain Number 1 Region: 8-124
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-28
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 
Domain Number 2 Region: 419-687
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.8e-17
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 3 Region: 136-214,305-359
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000123
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002936   Gene: ENSXMAG00000002919   Transcript: ENSXMAT00000002941
Sequence length 876
Comment pep:novel scaffold:Xipmac4.4.2:JH557195.1:1030:96170:1 gene:ENSXMAG00000002919 transcript:ENSXMAT00000002941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLQFSKSMVLDVYSDYVNNFTNAMALIKKACMSKPAFLEFLKRKQASSVDRITLYGLMV
KPIQRFPQFILLLQDMLKNTPKGHVDRLPLQLALTELETLAEKLNEQKRVADQIAETQQL
ARSVSDRLLSKQLNSEQRSLVLCETLIETVYGERGQVLKSKERKVFLFDDVLICANINVK
GPPDISSLVPVGPKYTMKWSAPLQHVQVVEVGQENSQSKDTLFQQSGTKRPSGACNSGKA
LLGPPRLYQELQELQHDLSVVEEVTLLVGTLQGIYQNLNTTVSQDWCLALQRLIRIKEEQ
IQCANKCRLRLQVPGRPDKSGRPVSFMVVFNTPNPLSKISWVNRLHLTKIALREENSRGW
LYGEDEGKTIVPFSCPLLACHMPVFATKSAERKLETALHNPVNCALLGFSAASTSLPQGY
LWVAGADEGFQGHIEIFSLNRPTPRAVKSLQISSAIRCLEYVQAPSPTEEEDVGIHKATA
GTGTNICVGLDDGRILVYGSADTAAQCLLTLHNPEGCPVLCLKHSARFLFAGLRNGTVMV
YGRNNNDDLWETESPICVSLGAEPIRTLLVLDESVWASCGNSVTVIQISTLTTQQKFEVH
PDPMISVTHMACAGGGVWMAFSEGSSIRLFHTETLELLQEINISTRSMLQNTGQKNMRVT
SLLICQGLLWVGTAQGLIITLPVPKLEGIPKITGKGMISLNAHCGPVDFLVATTSILSPD
LLKRDSVGDGPDSACGGEDRSDSSSQESLQPSSCYKAEEKGKGRGVLLQYRLRSTSGLPG
RPLTAHGDEASDSSLESLEHSVEDGSIYELSDDPEMWVRGRPCEKDAVRRDRVISAAVIS
GGKGFRRLKEGVGIGSRTSGDSLENTLMVWQLPLTV
Download sequence
Identical sequences M3ZL44
ENSXMAP00000002936 ENSXMAP00000002936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]