SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002977 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002977
Domain Number 1 Region: 203-346
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-36
Family Third domain of FERM 0.0034
Further Details:      
 
Domain Number 2 Region: 99-205
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-30
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 3 Region: 18-99
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.03e-28
Family First domain of FERM 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002977   Gene: ENSXMAG00000002966   Transcript: ENSXMAT00000002982
Sequence length 573
Comment pep:novel scaffold:Xipmac4.4.2:JH556685.1:1351662:1405547:-1 gene:ENSXMAG00000002966 transcript:ENSXMAT00000002982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRFMSGSLRNLEREYSCTVRLLDDTEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGI
RYVDPDKQRHWLEFTKSISKQMKSQPPFTMCLRVKFYPPDPVALKEEITRYLVFLQLKRD
LYHGRLLCKTSDAAMLAAHILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLERRIAEIHK
TELIGQTPETSERNFLLKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVLQGNKRVHF
LKWNEVSKLKFEAKTFHIYANQKEDRKIILTYFAPTPEACKHLWKCGVENQAFYKLEKSS
QVRTVSSSNLFFKGSRFRYSGRVAKEVMEQSARIKREPPEIHRSGLVPSRSCPSITHGPR
LSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSVSHGESFLPRSRSHATDASEGMAVIS
DEAYSPSDSVLPTPVAEHSTDMAVSRQINGAPCSIEEEKESEAGTPMRGEEGDFGVDGRA
AHEGAGEDSALSEVEQVNKFVLSVLRLLLVTIGLLFVLLLLLIILTESDLDIAFLSDIRQ
TPEFEQFHYEYFCPLRRWFACKLRWVGGLLINN
Download sequence
Identical sequences M3ZL85
XP_005798277.1.87360 ENSXMAP00000002977 ENSXMAP00000002977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]