SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003308 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXMAP00000003308
Domain Number - Region: 428-544
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0556
Family DBL homology domain (DH-domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003308   Gene: ENSXMAG00000003280   Transcript: ENSXMAT00000003313
Sequence length 1260
Comment pep:novel scaffold:Xipmac4.4.2:JH556773.1:50419:64006:-1 gene:ENSXMAG00000003280 transcript:ENSXMAT00000003313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCELLATCSALGYLEGDSYHKEPDCLESVKDLIRYLRHEDDTRDVRQQLGDSQIVQNDL
LPIIVQYRQDKTLFDACIRLMVNLTQPAMLCFGKIPDDPVFRQHFMQVTSHLQAYKEAFA
SEKVFGILSETLYNLLQLDWEQRQDEDNLLIERILLLVRNVLHVPADPCEEKKVDDDASV
HDRVLWAVHMSGFDDLVKFLASAQSEQQWSMHVLEIISLMFRDQTPEALVSAGHARSAEE
KQRDAQELEALRQKEQAEKRSRTLQRGTRHSRFGGSFVVQGLKAIGEKDVIYHRNLNNFK
CYTHDLGKAVRRVPKRNRQAQDCRDKRRSALNVRLFLREFCVDFLENCYNRLMYLVKESL
IREQTQQHDETYYLWALSFFMAFNRGNGFHADLVSETMSVRTFHFIERNITNYYEMLLTD
RKEATSWSRRMHLALKAYQELLLTVNEMDRSADEGIRQSSNVIKSNIFYLMEYREIFLTL
LRKYDETKQPHSYLKDLVESTHLFLRMLERFCKGRKNLIVQRKKVRRKKSQGKKKQPAQE
SSPEVLEETWKIVEEELRATEFQVSASLTESIVPFDAASETPLEEQRTEAMVRVQDALLA
RLGPEALALLRAAREVWPDGDVFGSSDVEPEEELDLLKQIFQANLPRPPPETIAEDDDEG
AELEEEELESVQLSEKEFNILDFIKRFANPSIVRSYLLLLKSYSKNTPHTNHCVARMLHR
LAVDLKMDALLFQLSVFHLFNKILNDPAADAYKELVTFAKFVLKRFFAVAAQNNKAYVEL
LFWKNVGAVREMTEGYTKDGEGKKPSWTEAEEEELRRLYMEHLDSEVPDIVETVIQLLSN
SNRTRRQVVTQLVHMGLVDNAKELKKQKKGTQIVLWTEEQEQELEMLFEEYKDSDDVLGD
IMKKLTAKRSRARVVDKLLSMGLVSERRQLHKKRSRSSHGKSSWKSSGKDMTEEDFLAEL
TQGLADEAADEDDEDETEDESADSEEDENEREIPQPVRKRRQDFNLTAERRADIRSMVKA
LQQEGLSGPLLWLQNSLNKTAIDRNDDCPFQPVPLCPFSEENEDAMENRNFLKLLSKLGI
RPPENEQETFWRIPENISTSQLCSVAAALTPGEDEPEHSEEQQGPRESPEEPQEQAEEEE
EDDEEREQRAQALRALLLARSRKSHSVEDAGLVSDSAPAGEANSLSERSQEKMPTKRSRN
RILDDDDDDDEEEEEEKDNDSSKAMDVDTNKDADSDTEDFSAPVKRRRKMAVIDDEEDED
Download sequence
Identical sequences M3ZM66
ENSXMAP00000003308 ENSXMAP00000003308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]