SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003527 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003527
Domain Number 1 Region: 824-1113
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-73
Family Protein kinases, catalytic subunit 0.00000395
Further Details:      
 
Domain Number 2 Region: 513-807
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.41e-49
Family Protein kinases, catalytic subunit 0.0000809
Further Details:      
 
Domain Number 3 Region: 367-495
Classification Level Classification E-value
Superfamily SH2 domain 8.4e-18
Family SH2 domain 0.0027
Further Details:      
 
Domain Number 4 Region: 272-381
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000148
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 5 Region: 144-255
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000701
Family Second domain of FERM 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003527   Gene: ENSXMAG00000003465   Transcript: ENSXMAT00000003532
Sequence length 1124
Comment pep:novel scaffold:Xipmac4.4.2:JH556952.1:53391:82902:1 gene:ENSXMAG00000003465 transcript:ENSXMAT00000003532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFILLTDMDPLSSNPTTLDGLSTDPDPKQEVKAVTLTLHLYHLGKTEERSSCSEDTLTF
PPGEYVAEELCITAAKACGISPVYCSLFCLMRENDRIYFPPNHIFKLHNSASENLHFRIR
YYFPGWYNSSSSFYAHRYGLSKEMESPVMDDCVMAYLFAQWRSDFLNGWVHIPVSHESQE
ECLGMAVLDMMRLAKESNLSPVDIYNDTSYKSFLPRCMRNRIQEYNLLTRKRIRYRFRRF
IQQFSECKATVCNLKLKYLMNLEMLLPSVYSERFQVTDLSSREVTIVVMGNKGILWSKGK
GEEGAEEELEIYCDFPEVIDISIKQGSKEGSAESRIVSLTRQDSQILELEFQLLSEALSF
VSLVDGYYRLVADAHHYLCKEVAPPRLLECIQSYCHGPVSMEFTISKLRRLGNYQGLYIL
RCSPREYDKFFMSFVVGYETMVDYKHCQIVKTESGEFILSGAKRSFGSLKELMHCYQKEA
LRTDGYTFQLIRCCPPSQKDKSNLLVCRNNQTTDVPPSPSLHKHISQMVFHKIRKEDLIF
NESLGQGTFTKLFRGVRKELGDYGEVHQMDVAVKILDKAHRSFSESFFEAASMMSQLSHK
HLLLIYGVCVCGDENMMVQEYGKFGSLDIYLKKKKNCVNITWKLEVAKQLAWAMHYLEDK
SVVHGNVCAKNILLIREEDRKTGSLPFIKLSDPGISITVLPREVLVERIPWVPPECIENP
QNLSLATDKWGFGTTLWEICSGGEKPLSTLDSSKKNLFYEDRHQLPAPKWTELANLINSC
MDYEPLHRPSFRTIIRDLNSLFTPDYELLVESDMVPNRTRGFGFPWASVSQEPAQFEERH
LIFLKQLGKGNFGSVEMCRYDPLQDSTGEVVAVKKLQHSTAEHLRDFEREIEILKSLHHE
NIVKYKGVCYSAGRRNLRLIMEYLPFGSLRDYLIKHKDHIDSIKLLHYASQICKGMDYLG
GKRYIHRDLATRNILVESEMRVKIGDFGLTKVLPQDKEYYTVREPGESPIFWYAPESLTE
SKFSVASDVWSFGVVLYELFTYSDKNCSPPAVFMEKIGNEKQGQMIVYHLIDLLKQGYRL
PAPENCLKEIHKIMMECWSSDPKLRPTFKALIQRVETVRESKDG
Download sequence
Identical sequences M3ZMT4
ENSXMAP00000003527 XP_014328382.1.87360 ENSXMAP00000003527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]