SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003552 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003552
Domain Number 1 Region: 240-446
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-56
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 430-563
Classification Level Classification E-value
Superfamily PH domain-like 2.08e-29
Family Pleckstrin-homology domain (PH domain) 0.0082
Further Details:      
 
Domain Number 3 Region: 619-789
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-22
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003552   Gene: ENSXMAG00000003528   Transcript: ENSXMAT00000003557
Sequence length 812
Comment pep:novel scaffold:Xipmac4.4.2:JH556788.1:1421418:1433155:1 gene:ENSXMAG00000003528 transcript:ENSXMAT00000003557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPKPQVPPKPPHLQQQAGAMRPRPRVPEKSLPPPPPCRPLPADPPGGAGPPPADGTASP
TCVLSLIEKFEREQIIVVPDITGGALCPRPLDPPSPRSSSPPSSASPVPPQPGGAEPPNQ
SELPSERLSLPSSQTDGKLANRDSGIDSISSPSHSEELCFAGVDDGGVAYPCSPALLPRL
SSSSSTAGEVGEGEEPRGRARRRDFSEEGDSDLEEEAELTLVLAPPKPDRQESVELSVHQ
RVFNIANELLLTETAYVSKLHLLDQVFCARLLEEARCRSSFPCDVVQGIFSNICSIYCFH
QQFLLPALQKRMEEWDSNSRIGDILQKLAPFLKMYGEYVKNFDRAMELVNIWMERSAPFK
AIVQEIQREERCGNLTLQHHMLEPVQRIPRYELLLKDYLNRLPEDAPDHRDAQKSLELIA
TAAEHSNAAIRKMERMRKLLKVYELLGGEEDIVNPTNELIKEGHILKLSNKNGTTQDRYL
ILFNDRLLYCVPKLRLIGQKYSVRARIDVDGMELKETSSVAVPSRTFLVSGKQRSLELQA
RTEEEKKDWIQAIQATIQRHEQTMESFRHLTCSLRDDESTPPHSPSCVELGKRAPTPIRE
KEVTLCMKCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLSYDNNRTNRVCVDCYVTLV
GASPTPGAMSSSSQRRRSILEKQASLAAENSVICSFLHHMEKGGGRGWQKAWFVIPENEP
LVLYVYGAPQDVKAQRSIPLIGFEVSPPESCDRLERRHAFKISQSHLTLYFSAEGEELQR
RWMDVLSRAGRGGGASHPSANRGERGGRRGGA
Download sequence
Identical sequences M3ZMV9
ENSXMAP00000003552 ENSXMAP00000003552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]