SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003600 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003600
Domain Number 1 Region: 31-224
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.09e-36
Family Regulator of chromosome condensation RCC1 0.0057
Further Details:      
 
Domain Number 2 Region: 1387-1672
Classification Level Classification E-value
Superfamily VPS9 domain 3.4e-28
Family VPS9 domain 0.0062
Further Details:      
 
Domain Number 3 Region: 524-639,669-696
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.24e-26
Family Regulator of chromosome condensation RCC1 0.022
Further Details:      
 
Domain Number 4 Region: 1063-1152
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 9.81e-20
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0076
Further Details:      
 
Domain Number 5 Region: 1162-1265
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 7.72e-16
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0071
Further Details:      
 
Domain Number 6 Region: 927-1027
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000102
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 
Domain Number 7 Region: 703-911
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000785
Family DBL homology domain (DH-domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003600   Gene: ENSXMAG00000003567   Transcript: ENSXMAT00000003605
Sequence length 1687
Comment pep:novel scaffold:Xipmac4.4.2:JH556860.1:404902:438114:-1 gene:ENSXMAG00000003567 transcript:ENSXMAT00000003605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEKPEESPADERGLQPPDRGLLHVWPSGGGTQQLCPETVLLSRPVMHVSLGENHGILLA
QGGLVFSFGELFWRGISVPVSAPVLEASLLGRMVVHVAAGGFHCGAISEQGGVYMWGENT
AGQCGQTDRASVINTTVPEPCPVTVVDSEVVPPAVVRVVSLACGREHSLALSAQNELWAW
GSGCQLGLVTNTFPVWKPQKVEHLAGRHVIQVACGAYHSLALVRSLPAQDFIAQSTPKIR
ERGRSPQCPLADREELVTTDDAVYCPLGVELSEVTRSETSSRRRVPRPRLHPAGKSSGSS
RGSSASLSSFSDDSRSNPKQKNFPACSRLEAEENRTECMLQADGSPKANPASDWAANKDS
AFSDDLELLNLLDKLSVQSESQNATATGDTDSVSSQTGSEDSCISSTPSSDLLTSSYKDD
SIFKMQTNNGVASAPLSSSPVCLEEVRLCVERERQAPLSCSLTNAHQKGNAAAAAAAAAS
GRRSLPGTPTHGSPRRRHQGASGSLCAGAGSDDSGDGLPSLETEVWSWGRGSEGQLGHGD
QLARLQPLCIKSLTGQEVIKVAAGSHHSLALTAQCQVYSWGSNLCGQLGRVDGPATVPQL
TKLSDGLRVWDLSAGQSHSLLLADGDCVQPVLLYCGQQSESPSAQSEKLQSRSSCQSSPL
KAKSCTARPTLLPFCIEMSYISSVSGGGRLCAALMDHNVMGFIAAIHDLASRERRFSCWM
NDVRRVIIAPLRKKETACQTLGDPCTHLFFALCDSFIQLSKLIGRHATALSYFLQNAQSR
DVTSFALLKHSEHFLETYKKYCSAVGDFQVMGGFQSLHKLSLDWLCGQQAVLSQLCGSDQ
SVSKEVDLVSMFYQPLQQLHHYSRVLLKMATCYDVLTEEYQSLHQGCSHYEVLSLSLLRK
KKEAETTQLFWKTHSGKTTESLRLPQRRVVCESSNRSLTPQYAGRFSNHWFILFNDILVH
TQGSLPPQSFFSSFRIYPLTCLWVKTITEDGSGLYTIKIICPEESLVLVASTPQEKNKWL
RSLNQAVDLVLGGAAQGSSPGVTAAVCRTASYKFVSDERFKDAQYSGGWMAGRVHGRGTM
KWPDGRVYKGNFKGGLEDGYGECVMPNKVQDKPDVYQGQWKEGKIHGFGKYKYGSGEVYD
GCFCDGRRHGYGMLSSGKLAGASSGLFIGQWVQDKKTGYGVHDDITRGEKFMGFWLDDQR
HGSAVVLTQYGVYFEGSFKENKMSGSGLLVSDDDTVFHGEFSDDWTINGKGVLTLANGDR
LDGLFSGEWSAGLKVVGTYVKPAMDDNKEKDEPPLGQYAVPAAQRWICVFDECWSRLGCD
AAGRGERTAAWENIAVTIATARRQSPDLSKSHTKVLESLEFIPQYGEAVTTANYDNIRRY
LTKACETPHHPLGWLVETLVTAYRMTYVGVGSNRRLLRQAVLELQAYLTHFYSIVRFLFP
GLPDDGGVIPDAPDISPYKTRRNSNKMDQGVLVVSCSSLLLPLLLPRLYPPLFTLYCLQQ
EPEEAQYWERILRLNKQPDQALLGFLGVQEKFWPHWMSILGEKKQIVSSSKDACFISAVE
TLQQISTTFTPSDKLLVIQKTFEELTLEVKPFLAGDFLWCMDDLFPLFLYVVLRARCRFT
SCPVRMFLSRFCSSRSYFCRVRNLGAEVSLIEDLMDPNLQHGEMGLMFTTLKVRKSNNHQ
NTDHTGA
Download sequence
Identical sequences M3ZN07
ENSXMAP00000003600 ENSXMAP00000003600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]