SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003706 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003706
Domain Number 1 Region: 907-1191
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-88
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000112
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-27
Family Second domain of FERM 0.00041
Further Details:      
 
Domain Number 3 Region: 215-329
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-21
Family Third domain of FERM 0.0099
Further Details:      
 
Domain Number 4 Region: 23-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.34e-18
Family First domain of FERM 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003706   Gene: ENSXMAG00000003682   Transcript: ENSXMAT00000003711
Sequence length 1195
Comment pep:novel scaffold:Xipmac4.4.2:JH556706.1:94589:119688:1 gene:ENSXMAG00000003682 transcript:ENSXMAT00000003711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGLKLRRTRRYNVLSKNYFVTRIRLLDNNVIECTLSVESTGQECLEAVAQRLELRETH
FFGLWFQGKTQTPAQRWVELEKPLKKQLDKFGNEPQLFFGVMFYVPNVSRLEQEATRYQY
YLQVKKEVLDGHLQCTVERGIRLAGLAVQADFGDFTHFQSQDFLREYVLFPVNWPNGDEV
LEEWTKKVAEEHKSHCGRPPAEAELLYIKEVEKLDGFGQESFPAKDNYTNDIFIGMSFVG
VFVKHRNGRSIMLHKWKDIGTIAHNKSAITVEITSRDDTINFHMEDMEMAKYIARLFTAR
HKFYKQNKICTEPTHSPAPIRRRPTWTHRLSLPRPQSCNFQSVHEHYQDMQSSQDSIFHE
DLYYKSETSLDLTFRNGTVPNGSMYSSPSLSSLNRSQTFIPPSPMSSNLSIPGSELMRPD
YIPSHRHSAIIAPSYRPTPEYEAVIRQKRRIVPTHHDLHSQSLRSLNISNACAYRKPEAL
VYSQPEMRERGPYHGPGPNPGPYTPQLLVNHGPCHSPCINGVGDSSGDVGSSISHTVSTP
ELANTKQQGASMGNYAVNANMLRNHMSRPPPPYPSSSFRPATSTPDLASHRHRCIGGSSP
ELVTRMVQLSVKTFQPDSSAVVHQSLQEVSEPLTAGAKHRSTLDKRHSMEFISSMRGGGI
EGLAMKGMNTTLHRRNTLREQKPSQNAPEAAVAPPTGVAYQHQKTLSNATMLIHSSDSEE
EEEEERPELDVQIPGLNDNISISAQLQAALAKLPNKPPPEYPGPPRTNASSQIRGPSHST
AHQGVGGPVTGSGAGGGGTLTRGDQSGVNGAVLGPSISEPDLTSVKERVRKEPVKERPVS
EMFSLEDSIVEREIAQRTLERQKMSVDSMRRPLMMAALNGLYVARMPVAKNQAEEGAKST
SDERCETLELKLEEDRVFTEYEQVPKKRTDCLLTTATLPENAERNRFRDVVPYEENRVEL
VPNKENNTGYINASHIKVMIRGEEWHYIATQGPLANTCGDFWQMIWEQGVNVIAMVTAEE
EGGRSKSHRYWPKLGSKHNSATYGKFKVTTKFRTEYNSYATTGLKVKHLLSGQERTVWHL
QYTDWPEQGCPEYVPGFLSYLEQIQSVRRHTNTMLDTSKSLNPPVVVHCSAGVGRTGVVI
LAELMISCLEHNEPVEVPTMLSELRHQRMLMVQTISQYKFVYQVLIQFLKNSRLI
Download sequence
Identical sequences M3ZNB3
ENSXMAP00000003706 ENSXMAP00000003706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]