SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003794 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003794
Domain Number 1 Region: 539-755
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-53
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 233-376
Classification Level Classification E-value
Superfamily PH domain-like 2.27e-43
Family Third domain of FERM 0.00056
Further Details:      
 
Domain Number 3 Region: 740-862
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-31
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 900-1026
Classification Level Classification E-value
Superfamily PH domain-like 9.71e-31
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 
Domain Number 5 Region: 132-235
Classification Level Classification E-value
Superfamily Second domain of FERM 8.5e-26
Family Second domain of FERM 0.0000989
Further Details:      
 
Domain Number 6 Region: 52-132
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.58e-16
Family First domain of FERM 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003794   Gene: ENSXMAG00000003776   Transcript: ENSXMAT00000003799
Sequence length 1047
Comment pep:novel scaffold:Xipmac4.4.2:JH557027.1:222591:260457:-1 gene:ENSXMAG00000003776 transcript:ENSXMAT00000003799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGSYRVLQTPGTRLGAQFNAGISTLEPGQSLSGNMVGGSKSHGLGLQIRVQGLDDS
QEFFVIDPKLPGQNLLSEVFHRGNFIESDYFGVEFQNMQMNWVWLEPTKPIARQVRRPAN
TLFRLSVKFFPPDPGQLQEEYTRYLFSLQMKRDLMEGRLICTENTGALLTSHIVQSEIGD
HDDAADREFLRANKLLPYQDKVQERIMEFHHRHLGQTPAESDFQILEIARKLEMYGVRFH
PAADREGTKINLTVAHMGLQVFQGNTKINTFNWSKIRKLSFKRKRFLIKLHPEVHGPHQD
ILEFMMASRDQCKNFWKICVEYHSFFRLFDQPEPKTKAILFTRGSSFRYSGRTQKQLVEY
VRENGAKRTPYQRKNSQVRMSARSFTSDMPKQTLSFSDSPRAPCSLSSTTESFLPAHMTR
IFPRTELQPQLQPFSALSPSPAAQQPPQFPAGAARPPSPPKEVSVKAVPPSHFSLQDSVM
DNPQLSPLTSKGPLSLSPSFQMSTLSLPSQAPSPLQSPILSEVGSTARLEEEEEGRRKRY
PTDKAYFIAKEILTTERTYLKDLEVITVWFRSAVIKENAMPEGLMTLLFSNIDPIYEFHR
GFLKELDQRLALWEGRSNAHVKGDYQRIGDVMLKNMSALKEFTSYLQKHDEVLTELEKAS
KRIKKLETVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILERLCKHYSPAHRDYEDCKE
AMKEVAEIATQLQSSLIRLENFQKLTELQRDLIGIENLTAPGREFIREGCLYKLTKKGLQ
QRMFFLFSDMLLYTSKGVTATNQFKVHGQLPLHGMIVEESENEWSVPHCFTIYSAQRTIV
VAASSKVEMGKWIEDLNMAIDLAKKSQEKSGVFLSTGLNDHSNIFGSPAVSPELPPRYLL
GQGQRPNTITHVCWYRNQNLSLTDYLRMNQNQLSGYLLRKFKNSNGWQKLWVVFTNFCLF
FYKTHQDDFPLASLPLLGYTVSTPDESDSIHKEYVFKLQFKSHVYFFRAESEYTFERWME
VIKSAASTTGRMSLLIPKGGAVEVNGS
Download sequence
Identical sequences M3ZNK1
ENSXMAP00000003794 ENSXMAP00000003794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]