SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004112 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004112
Domain Number 1 Region: 380-641
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-77
Family Protein kinases, catalytic subunit 0.0000000449
Further Details:      
 
Domain Number 2 Region: 822-963
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.62e-56
Family FAT domain of focal adhesion kinase 0.00000963
Further Details:      
 
Domain Number 3 Region: 101-222
Classification Level Classification E-value
Superfamily Second domain of FERM 7.2e-41
Family Second domain of FERM 0.0000206
Further Details:      
 
Domain Number 4 Region: 2-99
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-32
Family First domain of FERM 0.00055
Further Details:      
 
Domain Number 5 Region: 223-328
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-28
Family Third domain of FERM 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004112   Gene: ENSXMAG00000004048   Transcript: ENSXMAT00000004117
Sequence length 966
Comment pep:novel scaffold:Xipmac4.4.2:JH556706.1:1031251:1042644:1 gene:ENSXMAG00000004048 transcript:ENSXMAT00000004117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKILKVCFCTNNNLGKNFKLVKCDSSWKIQAIIRSILISGRLGPNVELSKCYGLMLKHLK
SEELHWLHPDLTVGEVEQRYESHHVEAEWRYDLRIRYIPINFLEKFKNDRSTFLYFYQQV
RSDYMQCHANKVSDGMALQLGCLEIRRFYKDMNAKGLEKKSNFELLEKEVGLDLFFPQQL
INSMKPKQLRKMIQQTFQQYATLKEDDCMIKFFETLKTFTNFDEEVFPCELVQGWSLSVE
LVIGGRGIRQRSQKDSAALFLTDFKQIKKIQCLPQTNDKALLNISVEGAKQNLSISVASV
PIAENMMDLIDGYCRLENDTDDSVIYRPNKDAKSARVSLPDIPTRNKYTMSLLIQSASPF
GFSGSDIYCEILDERPKSAVKYGIDRNDIVLGRILGEGFFGEVYDGVYKRANGERVNVAV
KTCKDCSSEVMEKFMSEAVIMKNLDHPHIVKLIGVIEDNPVWIVMELYQYGELGRYLTQN
QSKLTNTTLVLFSLQICKALVYLGGCNVVHRDIAVRNVLVASPECVKLGDFGLSRYIEDE
EYYKASVTRLPIKWMAPESINFRRFTSASDVWMFAVCMWEIMSQGQQPFFWLENRDVINQ
LEQGIRLPKPENCPPALYSLMTRCWSYDPGERPSFTELVIKISDVHKMEKELDAERERDR
ARGTKFLEPKVNFADAPPKPSRMKPSRFGNTLSIGLHIQLNEALCASSPDLASPCEYQSP
IDSRNTLALPERSPRRRSMGESELIRMEPNNKEDAQRLWQRERQHMQETMRLQKEQMMED
KKWLQKEERLLDPMGQDAVAISEPTEDDSEHVPPEKPPRLKTQAAPTAEIDRSDDKVYQY
VMDLVKVVVQLKNDITELQPEQYISIVKSVGMALRDLIRSVDDVLPSLHESIRTEIEGTQ
KLLNNDMAELISKMRLAQQNSITSLKEECKKQMLTAAHTLAMDSKNMLDAVDQARVRANI
AKPAAP
Download sequence
Identical sequences M3ZPG9
ENSXMAP00000004112 ENSXMAP00000004112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]