SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004354 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXMAP00000004354
Domain Number - Region: 171-269
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00327
Family DBL homology domain (DH-domain) 0.014
Further Details:      
 
Domain Number - Region: 37-72
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0706
Family MgtE N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004354   Gene: ENSXMAG00000004329   Transcript: ENSXMAT00000004359
Sequence length 677
Comment pep:novel scaffold:Xipmac4.4.2:JH556733.1:482677:501821:-1 gene:ENSXMAG00000004329 transcript:ENSXMAT00000004359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEQLKFIVQQLNMEPFRKNFNLITFDSLEPMQLLQILNDVLAEIDPKQAMDIREEMPEQ
TVKRMSSLLGMLKYKPPGNLSDVSSFRQGLVTGSKPVVHPILHWLLQKVPELKKRVYLAR
FLVKLEVPAEFLQDDIINDTYHQYEELVEGFKTYHKEREHLRSSGFSTAEIRRDINAMEE
EKDQLLKRVERLKRRVESVSNHQRMLEQARQLRVEKEREESLTHQKQEQKNQLFQAEQRL
LRLQQQLKDLRQAAADAHPESLMKRLEEEIKINSYMVTEKLPKELEGLRRTVQYMQKVSS
EPAMGQADLQDMEGKIKEVDSQINQLIEKKMMRNDPMDDKLTLYRQQASIIIRKKESKAE
ELQEAREELAAAERELKQRSSQGQGSNGEEVIRGDELKRLVAKLRSKGTTYKKKRQEIAE
LRAEYGVLQRTEEILRQRHDAVQQKLQTVEAQKGISGYSDTQEELERVSAIKSDLDEKKG
RTLDDMSEMVKKLNSMIVEKKSALAPIIKELRSLRQRRALLVMFCFGFYSFFSFAQSMGM
RSHQELKSQEVKALREEMAQKENRYHYINSVSEIIEMQIQRAAEEMKAYVSSDPQEKKKT
IREVYMKNIAEQELLGKKLREEQKVVRENHSANMEQMKMWRDLEQLMECKRQCFIKAQNQ
VSIGQVIQEGGEDRLVL
Download sequence
Identical sequences M3ZQ61
ENSXMAP00000004354 ENSXMAP00000004354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]