SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004388 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004388
Domain Number 1 Region: 1063-1235
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.92e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000517
Further Details:      
 
Domain Number 2 Region: 489-705
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-46
Family DBL homology domain (DH-domain) 0.00057
Further Details:      
 
Domain Number 3 Region: 1-67
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 8.37e-29
Family Bcr-Abl oncoprotein oligomerization domain 0.0000596
Further Details:      
 
Domain Number 4 Region: 721-789,846-881
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-16
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 5 Region: 923-1045
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000281
Family Synaptotagmin-like (S variant) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004388   Gene: ENSXMAG00000004350   Transcript: ENSXMAT00000004393
Sequence length 1283
Comment pep:novel scaffold:Xipmac4.4.2:JH556733.1:503262:546611:1 gene:ENSXMAG00000004350 transcript:ENSXMAT00000004393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEPLGFVEAWRAQFPESDPPKMDLGSLGHIEQELDKCKSSIRHLEKEVNKERFRMIYLQ
TLLAKERKSYDGQRWGFKKMPSMNDRDLPSGGSEDRRSYTEEAPRDEEKQRGSCKTQRNT
GHPEEVVDGLCLAKQKERMSPVRHDPEPSDFPVGTGSVAALRSNFERIRRANSHTAGDSR
GLSVMGSQEKPFYVNMEYHHERGLVRVNDKEVSDKISTLGSQAMQMERKRSLHSLPGNLS
AAAGDLAKPVQRGKSTEGSYSFNGSPDDPEVSPHFLKGGAIRSGEGRPDRQPVECQPYTS
VYVGGIMGEGDTRVIHIRDRSMDEDPHLTWPRRSYSPGSFDDVGGGYTPDCSSNENLTSS
EEDFSSGQSSQVSPSPTTYPMFREKSRSPSQHSQLSIDSGSPPTPLSQKCLKQQGVPSIF
GVRKRGPMWPSDGDSFSHSESEPYMENPPSYGYDLELSEEHPPRHEPLSFSGSPSSSPRL
RSKSRNSRDTQSSGSLESTQSVELEQEKGQEMRKWVLSGILASEETYLSHLEALLIPMKP
LKAAATTSQPMLTIQQIETIFFNVPELHEIHKDFYDALLPRVQDWSHQQCVGDLFQKLAS
QLGVYRAFVDNYKVAVETADKCCQANAQFAEISEDLKVKSTKDCKDQSAKYSLETLLYKP
VDRVTRSTLVLHDLLKHTPSGHPDYPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEN
RQLLRDRFMVELVEGSRKLRHVFLFTDLLLCTKLKKQAAGKGQQYDCKWYIPLADVTFQT
IDDCESSPIPLVQDEEIDAMKIKISQIKHEIQRERRTTKGAKVIERLKKKLSEQESLLLL
MSPNMAFRVANRNGKGFTFLISSDYERAEWREIIREQQKKCFKSFSLTSLELQMLTNSCV
KLQTVHSIPITMSKEDDESSGLYGFLNVIVHSASGLKQSLNLYCSLEVDSYGYFVNKAKT
RVHRDSTEPNWNEEFEIELEGSQTLRLLCYEKCCAKTKQSKEEGEMTDKIVAKGQIKLDP
QTLQNKDWQRTVIAVNGIEVKLSMRFTSREFSLKRMPSRKQSGVFGVKIHVVTKRERSKV
PLIVRQCVEEIERRGMDEVGIYRVSGVATDIQALKAAFDSNNKDVCVMMREMDVNAIAGT
LKLYFRELPEPLFTDELYPNFAGGIALSDSVAKESCMLNLLLSLPEPNLVTFVFLLDHLK
RVAENESINKMSLHNLATVFGPTLLRPSEKDSKLSSTSQPLSMNDSWSLEVMAQVQVLLY
FLQLESIPAPDSKRQSLLFSTEV
Download sequence
Identical sequences M3ZQ95
ENSXMAP00000004388 ENSXMAP00000004388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]