SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004448 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004448
Domain Number 1 Region: 292-419
Classification Level Classification E-value
Superfamily Second domain of FERM 1.08e-29
Family Second domain of FERM 0.002
Further Details:      
 
Domain Number 2 Region: 421-524
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-23
Family Third domain of FERM 0.0051
Further Details:      
 
Domain Number 3 Region: 71-158
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-16
Family PDZ domain 0.014
Further Details:      
 
Domain Number 4 Region: 203-285
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000879
Family Ubiquitin-related 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004448   Gene: ENSXMAG00000004435   Transcript: ENSXMAT00000004453
Sequence length 1246
Comment pep:novel scaffold:Xipmac4.4.2:JH556696.1:1173651:1192215:-1 gene:ENSXMAG00000004435 transcript:ENSXMAT00000004453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDWDSFVSVLHLCSHRTKSSGWPPPSGTWSASQGPPNGWDMGTIREGRDCYINHVSQSNS
LEEVCLDGDKFVPPAPRKVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDEI
IMINDEPVSSAPRERVIDLVRSCKESIVLTVVQPYPSPKSAFISAAKKAKLKTNPVKVRF
AEEVIVNGQVPETVKDNSLLFMPNVLKVYLENGQTKSFRFDSNTSIKDVILTLQEKLSIK
CIEHFSLMLEQRAEGSASKLMLLHEQEMLTQVTQRPGSHKMKCFFRITFVPKDPVDLLRR
DAVAFEYLYVQSCNDVVLERFGSELKYDTALRLAALQMYILTINTKQSQKVSLKYIEKEW
GLALFLPPAVLSSMKEKNIKKALTHILKTNQNLVPPGKKLTALQAKVHYLKYLSDLRLYG
GRVFKSTLVQGEKHTEVTLLVGPKYGISHVINTKTNLVALLADFSHVNRIEMYAEDDNRV
RVDLHVLDVKPITLLMESVDAMNLACLTAGYYRLLVDSRRSIFNVAKNTTLGSFFTGHAA
KPKQNYQAIECAYSIPHKACENRNNQRCSQDYLDQECEYLDHSRCEVQPVYVTEIHQPQH
SVHMAERAECCRVPCSQTYLNIPRPKPPDSSKVSFIFGEPPLDSVNPQNLGYQRLMDEGP
EIADNYSHMYRRLEEDYKMMDAIEEGYPYSTKIFGPTECIEEPLLHDICYAETTDDAEDE
DDISCEEDLVMSDIDKPTLLTLSGSSDDIIDLTSLPPPPEVNDEEDNDVLLHSLNMAIAA
PPPGFRDSSDEDEQQGAGTRAQEACNDIPISLIDSVPTHRAEGSEEPLDDAVVSTLQALE
ALAASEEQSPAQSESSTGVQISRTFSPESSDSGNETNSSEMTESSELAAAQRHSENHLRM
HVAMTEGYRAMNEEKAEVCTTSDENPEEAKSSAVTSSQIFHSDGGEMEPDTMEIKSVSEF
FTKMHMGSLMSRQRGRQREAESSIQGDRCSSSEKFNSTSLDSAKEEPPHLVGKYNTFTVR
DSYYMNQLDLGRTHCKDRHQKWQQRAPGSKMAENLTPECANDSQASHADRLTAKGENQDS
DERNQQLNAHLISPSKGPFPAESDATSQDNKQKQIKFSQSEQDVTRMYEYHVSKRMSSIQ
SEGVHSLQSSQCSSIDAGCSTGSSSCVTPMDSPLCATDSMHVLSESSLKGMSYAAGAEEK
AYGPTVQGKVGHTMDPTLMRKIHAATSAEPGFGSSHKMPKIKETTG
Download sequence
Identical sequences M3ZQF5
ENSXMAP00000004448 ENSXMAP00000004448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]