SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004481 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004481
Domain Number 1 Region: 290-477,791-938
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.33e-114
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000557
Further Details:      
 
Domain Number 2 Region: 6-119
Classification Level Classification E-value
Superfamily DUSP-like 4.58e-36
Family DUSP, domain in ubiquitin-specific proteases 0.000000722
Further Details:      
 
Domain Number 3 Region: 146-217
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000224
Family UBX domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004481   Gene: ENSXMAG00000004421   Transcript: ENSXMAT00000004486
Sequence length 966
Comment pep:novel scaffold:Xipmac4.4.2:JH556676.1:785019:805287:-1 gene:ENSXMAG00000004421 transcript:ENSXMAT00000004486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGAADLDTQRGEIAALLKTQLRKGDTWYLADSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPVDNSGLLKDGDVLAIKEHLIDELDYILVPTEGWNKLVGWYGLTEGQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCEDSNMDNVITRRFSKADTIDMIEKEMRKLFSIPDEKETRLW
NRYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGSMASKSSGASNLSALPK
ISPSSLTNNHNSSFNSRNVKNSSYSLPSSYPTYSNSYDYSEQSRQSERSGLCGLSNLGNT
CFMNSAVQCLSNITPLTEYFLKDKYRDELNEDNPLGMKGEIARAYAELIKQLWSGKYSYV
TPRPFKTQVGRFAPQFSGYQQQDSHELLAFLLDGLHEDLNRIRKKPYIQLKDANGRPDKV
VAEEAWENHIKRNDSIIVDIFHGLFKSTLVCPVCAKVSVTFDPFCYLTLPLPMKKERTLE
VYLVRLDPVAKPTQYKLTVPKVGYISDLCTSLSSLSAVPAEKMIVTDIYNHRFHRIFATN
ENLSSIMERDDIYVFEVAVNRVEDADHVVIPVHLREKYKQSGYNHTSTPLFGLPFLIAVP
RTLSEDKLYNMLLSRLCRFVRSPVEEDEEDSEETQPPTQHTINGNATNGLLEEGSPSEME
TDEQDDESSQDQELPSENENSQSEDSVGGDNELENGVVAPQLSTKGQKTSGLHRKRLFTF
QFNNMGKTDFSLIKEDTKLIRFDEGHLRLSDRSYLSLDWEPEIKKKYFDETVVEDYEKHE
SMEYKPQKKAFFKLKDCIELFTTKEKLGAEDPWYCPNCKQHQQATKKLDLWSLPPVLVVH
LKRFSYSRYMRDKLDSLVDFPLRDLDMSEFLINPNAGPCRYDLIAVSNHYGGMGGGHYTA
YAKNKEDGKWYNFDDSSVSPASEDQIVSKAGYVLFYQRQDTVKGTGYFALDREEEEEEGC
LRRCAK
Download sequence
Identical sequences M3ZQI8
ENSXMAP00000004481 ENSXMAP00000004481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]