SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004545 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004545
Domain Number 1 Region: 242-439
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-43
Family DBL homology domain (DH-domain) 0.000000101
Further Details:      
 
Domain Number 2 Region: 432-558
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-32
Family Pleckstrin-homology domain (PH domain) 0.0000476
Further Details:      
 
Domain Number 3 Region: 164-229
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-24
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 4 Region: 2-125
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-21
Family Calponin-homology domain, CH-domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004545   Gene: ENSXMAG00000004492   Transcript: ENSXMAT00000004550
Sequence length 849
Comment pep:novel scaffold:Xipmac4.4.2:JH557029.1:426123:442576:1 gene:ENSXMAG00000004492 transcript:ENSXMAT00000004550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSAEQTVTWLITLGVLESPKKSVSDPEAFLQASLQDGVVLCRLLERLRPGTVDKFIQEP
RSDSECQRNIAEFIKGCGAFSVEPFVVSDLLQGLNFSKVLNSLVALNKATEELSVPGDGV
CVPHSSNIRIKSFDSLNTQSRSSKLQQPQYRSLDMSDGGVCGQLLVKARFAFQPTNEDEL
SFSKGDVICVTKQVDGGWWEGSLNDKTGWFPSNYVRELKGGDKTTDKPKCGTLKSPPKGF
DTTIISKTYYNMVLQNILEAESEYSRELQSLLGTYLRPLHPTDRLSSVDIGHIQGNLEEI
STFQQMLVQSLDEQTKLPENQQKIGGFFLNLMPEMKAIYVAYCSNHPSAVSVLTQHSDDL
REYMESKGASSPGNLTLTVSLSKPFTRMERYPALLKELDRHMEEQHPDQADLSAAMAAFK
SLAAECEEVRKRKNLELQILTEPIRNWEGEDIKTLGPVLHMSQVKVHTQNCQESNERFLI
LFPHTLLMLSASLRMSGFIYQGKMPLSGMLISRIEDGENLKNAFEISGGQCERTQIACSS
QRDLQDWLDLLTKHTHTTPPQVCKLQDVCYTLPSHPATHSRYSESRGASPYNTLPHPSLN
GTISSSTPMWGPLEPPSTPKPWTLSCLRPAPPLRPSAALCFKEDVSKSPKNKRPLLPTIR
KPERKPSEEDFTARKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLAE
TSLTVAALPSNLLSSDQSEDSDYDSIWTNQSHRTASFSRSSRKDVHMLFPEEEKIIVEET
RSNGQTVVEERSLVDTVYSLRDEVQELKQDNKRIKRTLEEEQRARKELERIVRRVLKNMN
DPTWDETNL
Download sequence
Identical sequences M3ZQQ2
ENSXMAP00000004545 ENSXMAP00000004545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]