SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004552 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004552
Domain Number 1 Region: 2269-2558
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.36e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000333
Further Details:      
 
Domain Number 2 Region: 679-787
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-30
Family Second domain of FERM 0.00031
Further Details:      
 
Domain Number 3 Region: 1104-1203
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-26
Family PDZ domain 0.0061
Further Details:      
 
Domain Number 4 Region: 789-907
Classification Level Classification E-value
Superfamily PH domain-like 2e-25
Family Third domain of FERM 0.0024
Further Details:      
 
Domain Number 5 Region: 1383-1479
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-25
Family PDZ domain 0.00018
Further Details:      
 
Domain Number 6 Region: 2021-2120
Classification Level Classification E-value
Superfamily PDZ domain-like 1.13e-23
Family PDZ domain 0.01
Further Details:      
 
Domain Number 7 Region: 1516-1619
Classification Level Classification E-value
Superfamily PDZ domain-like 1.26e-21
Family PDZ domain 0.014
Further Details:      
 
Domain Number 8 Region: 1805-1892
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-19
Family PDZ domain 0.012
Further Details:      
 
Domain Number 9 Region: 587-678
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.88e-16
Family First domain of FERM 0.006
Further Details:      
 
Domain Number 10 Region: 1903-1987
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000184
Family PDZ domain 0.035
Further Details:      
 
Domain Number 11 Region: 43-157
Classification Level Classification E-value
Superfamily PAZ domain 0.000000051
Family PAZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004552   Gene: ENSXMAG00000004518   Transcript: ENSXMAT00000004557
Sequence length 2565
Comment pep:novel scaffold:Xipmac4.4.2:JH556689.1:783813:831733:1 gene:ENSXMAG00000004518 transcript:ENSXMAT00000004557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALQVRGGPLQEEEVWALLSQSAESLQELFNKDPAAMGFIISPWSLLLMPSGNI
SFTDEYVTQEDLRAFTAPEVMEGNPLNSVSDIEKMHMYSLGMTLFWGADYQIPPSQPMKL
GEHLNGLLLNMSDDITLSRMSLRTVLDICSKHIRNSTCDPPFSYIRKLVRLVLGSLSQLD
GLLTDRESLPERSKEIRERLRGKGLPSGRSAAPRVLERYKARTQEQAALNRGLSRSMGSL
PILDLLKGDEGAAPHSSLSEYHTNSDSSTEFYSKAPSLQHQLSYPYLHPLHPQMKGRPVE
LDRRSLPYQITDRGPSQPRKTWASSVDLAYIDPEALRFGALEDARRGSSVLSTHSVGRRK
SPLSVAKEVDYRYSEFGELKGRMPHHFSALSVGSGLPAAYDRIKERQRKLQALQQAVNDP
VHTHQRYHSDYSSSSESPSVASSDPDYRLAKKPGEVTRYGSQLALAEQDALSLRSHNSQR
HRQNEGPADESAEMLLQRQEEEVQRLQTQLANRLSRSNFYSADEPLLQPQASALDLQDPL
YNPLSLRKNKNYHGPEFVKMASEPPVTLSVPSSIMQPKRNKVEEAQRKVGVVLLNGQKLE
LGCDLKAVCKDVFDMVVAHIGLVEHHLFGLAYLKETEFFFVEPDAKLTKVAPDGWKEHPK
KRRTDVPFNLFLRIKFFHDDVNLIQHAMTKHQHYLQLRKDILEERMRCNTENALLLASLA
LQAEFGDYQPELHGKTYFRLEHYLPVSILDKVDQTTLREELPKLHSNYYGASESEAEFEF
LKASQRLAEYGVHFHRVLPEKRSQSGVMLGIYSKGVLIFEVLNGNRTPALRFPWRETKKI
SFAKKKICLQNTSDEVKHLFQTDSNRTCQYLLQLCSDQHKFQLQSKARQNNQELQDLENC
PLSSMQYSVDSQGGDASARIARPVSLAQSLSTRSNPEHLKRISYSEVALNKTPAGSVLVH
DELHLPGYNPLASTAFTNPRLMSRSHHNLAQMSESEQNPVLDLLRSSNARLTQPQLNQAT
SNFQQRQRASSDTDSISHLQDKPLGSVLQNSPSWHLSQSKKESDSSSIEDNGQAYVVGVS
MHSSSGAPSTPASANDSLKKKLNELPTLEREITTVNLKKDAKYGLGFQVVGGENSGRTNL
GTIISSITPGGPADLNGLLKPGDRLISVNDINLDGYPHDETVNILQSAPDDVTLVVSQPK
ERLYQDKHSSPFVPQPPKSYFNSPKPAQRPEREVDPSSEEHHGTVSPVLPLQGAGIPTSA
FSPARQLSSLGSQDSRTSSSAKVNQPPRDRVQQALERVKAAASSETATESRGPEPKVELN
QSPPALPPKTRRVKLSVVPPVSEQSDRGDTDMDEETYSSSQEKVKAKKENIMENLNDNAP
GVNSLRPGDLFDVELSKIDSSLGINVTGGANTTVRHGGIYVKALIPKGAAELDGRIQKGD
RVLAVNGKSLEGATHHQAVDVLRDTGQTVHLRLEKGLSPVNSNQAPLTPQPNTRISASNH
TQTKDKEQPPEAKDKPEYSFVTQDNMFEVRLLKNTSGLGFSFSREEHPPDEPNGPSLVRV
KKLFPGQPAAESGRINVGDVILRVNQTSLKGLSQHEVISALRGTGQEVTLLLCRPEKGVL
RDMDASALTPKPSPRKVPVTITEPSLSLSRTASPPGTTSKTPVEEALARLNFKSPGRHNS
YSDSTDGDEEVEKAFTSSAFEHSLQNWDMSVYQTPGGNSELGRFDSSGQLDGTFHSAFYS
PILSKTRLDLSNRSSSSPVEADMESSPLPVISSASAPSPDPLPPPMSLPLKFKVPSNGQD
VEEVIPEAELMISLLKSEKGSLGFTLTKGNDQGCYIHDIVQDPAKADGRLRPGDRMIKVN
NTDVSSMNHTEVVSLVRAAPPLVDLVVGRILEAPKFPVEAHLLPDICFRSSQEPLGLVLD
GGRDSIYGVLFVKDVIPGSPASKEGSLKPLDLIHYINGAPTQDLTLSESTRLLELSLNDL
CLKATRDGMPVSPEHKHVTFLDNIGSKLSSSMNGFLKRNGSRDAEDLTGLCPAEEEIITL
DLEKPPSGGLGLSLIGGERGIFVKSITPGGVAESSGQLQVGDRLLKVNDDLMTNISHTKA
VTTIRKARGLVHLIVSRPPDQNPNTYLAYLPINSDKCNGNTDLSEDSGVTTKLRMLVEQK
STNILAIPPIDYDDGPLEEKKDTELSEDTDCDGSSLPEDSPVSSRKAMWQEESVDDPRNE
NSYLQMSAVQPEDEDFTWGSDELPIEKISSQSTDDKSIITKDELTTLPLVRVVPGGQYTG
TNLHSKVRVIKGLLDQKIPLQEFENLQNLQPLDDCLVGQTKENKKKNRYKNIIPFDTTRV
VIGKDGGYINANFINMQVKNEHFKYVACQGPLPTTLGDFWQMVWEQNSNVIAMMTQEIEG
GKVKCQRYWPDTPRTAEMVDDRLQITLIKDQHLDHFVIRLIEVKDVQTNETKLVTHLNYT
GWPDHGTPSQPEHLLTFISYMRHIHRSGPIITHCSAGIGRSGALICIDVVLGLISKDADF
DISDIVRNMRLQRHGMIQTEEQYIFCYQVALYVLRCLKAEENISG
Download sequence
Identical sequences M3ZQQ9
ENSXMAP00000004552 ENSXMAP00000004552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]