SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004654 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004654
Domain Number 1 Region: 1169-1390
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.22e-64
Family DBL homology domain (DH-domain) 0.0000000693
Further Details:      
 
Domain Number 2 Region: 1390-1530
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-29
Family Pleckstrin-homology domain (PH domain) 0.00000229
Further Details:      
 
Domain Number 3 Region: 237-341
Classification Level Classification E-value
Superfamily EF-hand 3.65e-29
Family Eps15 homology domain (EH domain) 0.0029
Further Details:      
 
Domain Number 4 Region: 1542-1641
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.34e-25
Family PLC-like (P variant) 0.0059
Further Details:      
 
Domain Number 5 Region: 1079-1165
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-25
Family SH3-domain 0.0000157
Further Details:      
 
Domain Number 6 Region: 9-104
Classification Level Classification E-value
Superfamily EF-hand 7.93e-24
Family Eps15 homology domain (EH domain) 0.0014
Further Details:      
 
Domain Number 7 Region: 961-1018
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-19
Family SH3-domain 0.00018
Further Details:      
 
Domain Number 8 Region: 756-832
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-16
Family SH3-domain 0.00026
Further Details:      
 
Domain Number 9 Region: 855-925
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000761
Family SH3-domain 0.0004
Further Details:      
 
Domain Number 10 Region: 1024-1098
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000122
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004654   Gene: ENSXMAG00000004605   Transcript: ENSXMAT00000004659
Sequence length 1674
Comment pep:novel scaffold:Xipmac4.4.2:JH556706.1:2204769:2228872:1 gene:ENSXMAG00000004605 transcript:ENSXMAT00000004659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLYFLSGGSSVWVITPEERGKHDKQFDTLAPILGYISGEQARKFFLQSGLPASVLAEIW
NLADMDSDGKMDRLEFSIAMKLIKLTLQGRNLPSSLPVTMKQPPTLNSSSNMSSSARFGM
GSMPNLSVGLSSMPTISTMPVLTPMLANRPLPSVQPLVPVPMTLPLITSFGSSGLPNGTV
SLLTSPLVPSNAATCTPMSGFSSPMAFSPSPGVSKANSLLDLGSSSSNSSSTTSLASNSP
KMGSGDWAVPQASRLKYRQQFNTLDKLMSGYLSGPQVRNALMASNLTQTQLATIWSLADV
DKDGQLRAEEFILAMHLVDMAKTGHPLPLTLPQDLIPPSLRGGIKSNELLNGTGPYISPS
LIDTTEIEPPQKNKSSVSYEDKLKENFARGSAELEKRRLALVEEQRKERERREREEKEAQ
DRREREARELENRRRLEEERWMERQREMERQREEERLRELERKEAAKQEMERQRREEWER
AKLEELGRRKETEQEEIIRLRARKKSLELELEAVGNKHKQISDRLRDAQSKRRIQKAEVD
LINQKRDARIAEINTLQLEFEEWQRKLSQLVPEQQQLSEKLRNISLKKLPSATLTSLMGS
AAESSGNCRHLKDQLDILEKETTDKLTQMEQYNKELKLGDMDDCLLRGLLSLLACLSQLF
LLIKELREKQTKQQAVLDDLHRVKEEKLRELQRRMEEERERRRREEAEAEKAQEEERRRR
DEEERKKRELEEEMKQKEMEEEKRKKQEQERGAAQLTSYRALYSFLGRNADELSIDADCL
IEVDEHTVGEPGWLCGNYRGKRGWFPQSYAEKCPTPPTSEMALPSSSLPPASVISEGSLL
PVLSRNAAVDATEDSSVPLFPAASQSTVLLAARAVSSWSPASETHLNLSPDGDLISVLQQ
RDDWWLGQLNGTRGWFPKSYVTPEPGGNTENKKNHSCGTAVPEEASYGLFIVYSDQSLSE
LEYVALYTYESPETGDLTFDEGDVIMVTEREGEWWRGCIGDQTGLFPSNYVRPVEPEYLF
PKASKSGVSIKKPEIVQAVTTTEAPMAYQLTLSPGQLIVVRAKNSTGWWLGELQARGKKR
QKGWFHSSHVKLLGPSSNKTCLSPLPVCQVIAMYDYAAANQDELSFSKGQLINILDKTNP
DWWKGEINGVTGLLPTNYVKMTTESDPSQQWCADLITLDTMTPQERKRQGYIHELFHTEE
TYVDDLELVLEVFHKPMSESGRLTEAEMATIFVNWRELIMCNTRLLNALRERKQTGGENM
PVQLIGDLLASELAHMQPYVCFCSSQLNAAALLQTKTHNQPEFKNFLKKVATNYRCKGMP
LSSFLLKPMQRLTRYPLLIKNILEHTPDGHEDREPLREALERAEELCSQVNEAVREKENA
DRLEWIQNHIQCEGPIEHLVFSSLTNCLGPRKLLHSGRLFKTKSSRELWTFLFNDFLLLT
HSAKPFSSSGSEKLFSPKTNMQLKIYKTPLFLNEVLVKMPADPSSEEPLFHVSHIDRVYT
LKTETLSERTAWVQKIKAASEHFIETEKKKREKAYQARSLKSSGIGRLLVTVIEAQELKA
CKPNGKSNPYCELTMGAQCYTSRPVLDTLNPKWNFNCQFFIKDIYQDVLSITVFEKDQFS
PDDFLGRAEVPVATIKKDMDSKGAATRRLLLHEVPTGEVSVKLDLQLYEQRNLP
Download sequence
Identical sequences M3ZR11
ENSXMAP00000004654 ENSXMAP00000004654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]